PDB entry 1taf

View 1taf on RCSB PDB site
Description: drosophila tbp associated factors dtafii42/dtafii62 heterotetramer
Deposited on 1996-06-01, released 1996-12-07
The last revision prior to the SCOP 1.71 freeze date was dated 1996-12-07, with a file datestamp of 1996-12-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1tafa_
  • Chain 'B':
    Domains in SCOP 1.71: d1tafb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tafA (A:)
pkdaqvimsilkelnvqeyeprvvnqlleftfryvtsilddakvyanharkktidlddvr
latevtld

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tafB (B:)
mlygssisaesmkviaesigvgslsddaakelaedvsiklkrivqdaakfmnhakrqkls
vrdidmslkv