PDB entry 1tab

View 1tab on RCSB PDB site
Description: structure of the trypsin-binding domain of bowman-birk type protease inhibitor and its interaction with trypsin
Class: hydrolase (serine proteinase)
Keywords: hydrolase (serine proteinase)
Deposited on 1990-10-15, released 1992-01-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2
AEROSPACI score: -1.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1tabe_
  • Chain 'I':
    Compound: bowman-birk type proteinase inhibitor
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1tabi_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tabE (E:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1tabI (I:)
    sghhdettdepsesskpccdqcsctksmppkcrcsdirlnschsackscactysipakcf
    ctdindfcyepckssrdddwdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tabI (I:)
    sesskpccdqcsctksmppkcrcsdirndfcyepck