PDB entry 1ta8

View 1ta8 on RCSB PDB site
Description: Structural rearrangement accompanying NAD+ synthesis within a bacterial DNA ligase crystal
Class: ligase
Keywords: Nucleotidyl transferase fold, LIGASE
Deposited on 2004-05-19, released 2004-11-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA ligase, NAD-dependent
    Species: Enterococcus faecalis [TaxId:226185]
    Gene: ligA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ta8a_
  • Heterogens: SO4, NMN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ta8A (A:)
    meqqpltltaattraqelrkqlnqysheyyvkdqpsvedyvydrlykelvdietefpdli
    tpdsptqrvggkvlsgfekaphdipmyslndgfskedifafdervrkaigkpvayccelk
    idglaislryengvfvrgatrgdgtvgenitenlrtvrsvpmrltepisvevrgecympk
    qsfvalneereengqdifanprnaaagslrqldtkivakrnlntflytvadfgpmkaktq
    fealeelsaigfrtnperqlcqsidevwayieeyhekrstlpyeidgivikvnefalqde
    lgftvkaprwaiaykfppeeaetvvzhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ta8A (A:)
    pltltaattraqelrkqlnqysheyyvkdqpsvedyvydrlykelvdietefpdlitpds
    ptqrvggkvlsgfekaphdipmyslndgfskedifafdervrkaigkpvayccelkidgl
    aislryengvfvrgatrgdgtvgenitenlrtvrsvpmrltepisvevrgecympkqsfv
    alneereengqdifanprnaaagslrqldtkivakrnlntflytvadfgpmkaktqfeal
    eelsaigfrtnperqlcqsidevwayieeyhekrstlpyeidgivikvnefalqdelgft
    vkaprwaiaykfp