PDB entry 1ta6

View 1ta6 on RCSB PDB site
Description: crystal structure of thrombin in complex with compound 14b
Deposited on 2004-05-19, released 2004-06-08
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-08, with a file datestamp of 2004-06-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.186
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ta6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ta6A (A:)
    dcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspqellcgas
    lisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpryn
    wrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwtan
    vgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvm
    kspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ta6A (A:)
    dcglrplfekksledkterellesyiivegsdaeigmspwqvmlfrkspqellcgaslis
    drwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihprynwre
    nldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlkegqpsvlqv
    vnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvmkspfnnrwyqm
    givswgegcdrdgkygfythvfrlkkwiqkvidqfg