PDB entry 1ta4

View 1ta4 on RCSB PDB site
Description: Crystal Structure Of Aspartate-Semialdehyde Dehydrogenase From Haemophilus Influenzae with a Bound Arsenate
Class: oxidoreductase
Keywords: Aspartate-Semialdehyde Dehydrogenase, Arsenate, Aspartate Biosynthetic Pathway, Haemophilus Influenzae, OXIDOREDUCTASE
Deposited on 2004-05-19, released 2004-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.225
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate-semialdehyde dehydrogenase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: ASD, HI0646
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ta4a1, d1ta4a2
  • Heterogens: ART, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ta4A (A:)
    mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqagqkapvfggkdagdlksafd
    ieelkkldiivtcqggdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhvi
    seglkkgiktfvggnctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqm
    glleqavsselkdpassildierkvtakmradnfptdnfgaalggslipwidkllpetgq
    tkeewkgyaetnkilglsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiias
    hnewvkvipndkeitlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwgaae
    pvrrilkqlva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ta4A (A:)
    mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqalksafdieelkkldiivtcq
    ggdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhviseglkkgiktfvgg
    nctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqmglleqavsselkdp
    assildierkvtakmradnfptdnfgaalggslipwidkllpetgqtkeewkgyaetnki
    lglsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiiashnewvkvipndkei
    tlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwgaaepvrrilkqlva