PDB entry 1ta3

View 1ta3 on RCSB PDB site
Description: Crystal Structure of xylanase (GH10) in complex with inhibitor (XIP)
Class: hydrolase inhibitor/hydrolase
Keywords: beta alpha barrel (xip-I), beta alpha barrel (xylanase), hydrolase inhibitor-hydrolase complex
Deposited on 2004-05-19, released 2004-07-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.135
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xylanase Inhibitor Protein I
    Species: Triticum aestivum [TaxId:4565]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8L5C6 (0-273)
      • see remark 999 (36)
      • see remark 999 (183)
    Domains in SCOPe 2.03: d1ta3a_
  • Chain 'B':
    Compound: endo-1,4-beta-xylanase
    Species: Emericella nidulans [TaxId:162425]
    Gene: XLNC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ta3b_
  • Heterogens: NAG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ta3A (A:)
    aggktgqvtvfwgrnkaegslreacdsgmytmvtmsfldvfgangkyhldlsghdlssvg
    adikhcqskgvpvslsiggygtgyslpsnrsaldlfdhlwnsyfggskpsvprpfgdawl
    dgvdlflehgtpadrydvlalelakhnirggpgkplhltatvrcgyppaahvgralatgi
    fervhvrtyesdkwcnqnlgwegswdkwtaaypatrfyvgltaddkshqwvhpknvyygv
    apvaqkkdnyggimlwdryfdkqtnysslikyya
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ta3B (B:)
    qsaslndlfvaagksyfgtcsdqallqnsqneaivasqfgvitpensmkwdalepsqgnf
    gwsgadylvdyatqhnkkvrghtlvwhsqlpswvssigdantlrsvmtnhinevvgrykg
    kimhwdvvneifnedgtfrnsvfynllgedfvriafetaraadpdaklyindynldsasy
    aktqamasyvkkwlaegvpidgigsqahyssshwssteaagalsslantgvsevaiteld
    iagaassdylnllnaclneqkcvgitvwgvsdkdswrasdspllfdgnyqpkdaynaivn
    als
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ta3B (B:)
    aslndlfvaagksyfgtcsdqallqnsqneaivasqfgvitpensmkwdalepsqgnfgw
    sgadylvdyatqhnkkvrghtlvwhsqlpswvssigdantlrsvmtnhinevvgrykgki
    mhwdvvneifnedgtfrnsvfynllgedfvriafetaraadpdaklyindynldsasyak
    tqamasyvkkwlaegvpidgigsqahyssshwssteaagalsslantgvsevaiteldia
    gaassdylnllnaclneqkcvgitvwgvsdkdswrasdspllfdgnyqpkdaynaivnal
    s