PDB entry 1ta3

View 1ta3 on RCSB PDB site
Description: crystal structure of xylanase (gh10) in complex with inhibitor (xip)
Deposited on 2004-05-19, released 2004-07-20
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-31, with a file datestamp of 2004-08-31.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.135
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ta3a_
  • Chain 'B':
    Domains in SCOP 1.69: d1ta3b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ta3A (A:)
    aggktgqvtvfwgrnkaegslreacdsgmytmvtmsfldvfgangkyhldlsghdlssvg
    adikhcqskgvpvslsiggygtgyslpsnrsaldlfdhlwnsyfggskpsvprpfgdawl
    dgvdlflehgtpadrydvlalelakhnirggpgkplhltatvrcgyppaahvgralatgi
    fervhvrtyesdkwcnqnlgwegswdkwtaaypatrfyvgltaddkshqwvhpknvyygv
    apvaqkkdnyggimlwdryfdkqtnysslikyya
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ta3B (B:)
    qsaslndlfvaagksyfgtcsdqallqnsqneaivasqfgvitpensmkwdalepsqgnf
    gwsgadylvdyatqhnkkvrghtlvwhsqlpswvssigdantlrsvmtnhinevvgrykg
    kimhwdvvneifnedgtfrnsvfynllgedfvriafetaraadpdaklyindynldsasy
    aktqamasyvkkwlaegvpidgigsqahyssshwssteaagalsslantgvsevaiteld
    iagaassdylnllnaclneqkcvgitvwgvsdkdswrasdspllfdgnyqpkdaynaivn
    als
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ta3B (B:)
    aslndlfvaagksyfgtcsdqallqnsqneaivasqfgvitpensmkwdalepsqgnfgw
    sgadylvdyatqhnkkvrghtlvwhsqlpswvssigdantlrsvmtnhinevvgrykgki
    mhwdvvneifnedgtfrnsvfynllgedfvriafetaraadpdaklyindynldsasyak
    tqamasyvkkwlaegvpidgigsqahyssshwssteaagalsslantgvsevaiteldia
    gaassdylnllnaclneqkcvgitvwgvsdkdswrasdspllfdgnyqpkdaynaivnal
    s