PDB entry 1ta0

View 1ta0 on RCSB PDB site
Description: Three-dimensional structure of a RNA-polymerase II binding protein with associated ligand.
Class: hydrolase
Keywords: alpha-beta protein, HYDROLASE
Deposited on 2004-05-19, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.207
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CTDSP1, NIF3, NLIIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9GZU7 (1-End)
      • cloning artifact (0)
      • modified residue (20)
    Domains in SCOPe 2.07: d1ta0a1, d1ta0a2
  • Heterogens: MG, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ta0A (A:)
    mqyllpeakaqdsdkicvvidldetlvhssfkpvnnadfiipveidgvvhqvyvlkrphv
    deflqrmgelfecvlftaslakyadpvadlldkwgafrarlfrescvfhrgnyvkdlsrl
    grdlrrvlildnspasyvfhpdnavpvaswfdnmsdtelhdllpffeqlsrvddvysvlr
    qprpgsaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ta0A (A:)
    mqyllpeakaqdsdkicvvidldetlvhssfkpvnnadfiipveidgvvhqvyvlkrphv
    deflqrmgelfecvlftaslakyadpvadlldkwgafrarlfrescvfhrgnyvkdlsrl
    grdlrrvlildnspasyvfhpdnavpvaswfdnmsdtelhdllpffeqlsrvddvysvlr
    q