PDB entry 1t9s

View 1t9s on RCSB PDB site
Description: Catalytic Domain Of Human Phosphodiesterase 5A in Complex with GMP
Class: hydrolase
Keywords: hydrolase, pde5a
Deposited on 2004-05-18, released 2004-08-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.177
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cGMP-specific 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE5A, PDE5
    Database cross-references and differences (RAF-indexed):
    • Uniprot O76074 (21-346)
      • engineered (145)
      • engineered (148)
      • engineered (150-152)
      • engineered (63)
      • engineered (154-158)
      • engineered (161-163)
      • engineered (165-166)
      • engineered (168-169)
    Domains in SCOPe 2.08: d1t9sa_
  • Chain 'B':
    Compound: cGMP-specific 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE5A, PDE5
    Database cross-references and differences (RAF-indexed):
    • Uniprot O76074 (21-346)
      • engineered (145)
      • engineered (148)
      • engineered (150-152)
      • engineered (63)
      • engineered (154-158)
      • engineered (161-163)
      • engineered (165-166)
      • engineered (168-169)
    Domains in SCOPe 2.08: d1t9sb_
  • Heterogens: ZN, MG, 5GP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t9sA (A:)
    mgsshhhhhhssglvprgshmeeetrelqslaaavvpsaqtlkitdfsfsdfelsdleta
    lctirmftdlnlvqnfqmkhevlcrwilsvkknyrknvayhnwrhafntaqcmfaalkag
    kiqnkltdleilalliaalshdldhpgvsnqflintnselalmyndesvlehhhfdqclm
    ilnspgnqilsglsieeykttlkiikqailatdlalyikrrgeffelirknqfnledphq
    kelflamlmtacdlsaitkpwpiqqriaelvateffdqgdrerkelnieptdlmnrekkn
    kipsmqvgfidaiclqlyealthvsedcfplldgcrknrqkwqalae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t9sA (A:)
    eeetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhe
    vlcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalsh
    dldhpgvsnqflintnselalmyndesvlehhhfdqclmilnspgnqilsglsieeyktt
    lkiikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpw
    piqqriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyeal
    thvsedcfplldgcrknrqkwqalae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t9sB (B:)
    mgsshhhhhhssglvprgshmeeetrelqslaaavvpsaqtlkitdfsfsdfelsdleta
    lctirmftdlnlvqnfqmkhevlcrwilsvkknyrknvayhnwrhafntaqcmfaalkag
    kiqnkltdleilalliaalshdldhpgvsnqflintnselalmyndesvlehhhfdqclm
    ilnspgnqilsglsieeykttlkiikqailatdlalyikrrgeffelirknqfnledphq
    kelflamlmtacdlsaitkpwpiqqriaelvateffdqgdrerkelnieptdlmnrekkn
    kipsmqvgfidaiclqlyealthvsedcfplldgcrknrqkwqalae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t9sB (B:)
    eeetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhe
    vlcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalsh
    dldhpgvsnqflintnselalmyndesvlehhhfdqclmilnspgnqilsglsieeyktt
    lkiikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpw
    piqqriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyeal
    thvsedcfplldgcrknrqkwqalae