PDB entry 1t9m

View 1t9m on RCSB PDB site
Description: X-ray crystal structure of phzG from pseudomonas aeruginosa
Class: oxidoreductase
Keywords: phenazine, phzG, chorismate, pseudomonas, OXIDOREDUCTASE
Deposited on 2004-05-18, released 2004-11-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.186
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable pyridoxamine 5'-phosphate oxidase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: phzG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1t9ma_
  • Chain 'B':
    Compound: probable pyridoxamine 5'-phosphate oxidase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: phzG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1t9mb_
  • Heterogens: SO4, FMN, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t9mA (A:)
    mgvnanisesltgtieapfpefeappanpmevlrnwlerarrygvrepralalatvdgqg
    rpstrivviaelgergvvfathadsqkgrelaqnpwasgvlywressqqiilngraerlp
    deradaqwlsrpyqthpmsiasrqsetladihalraearrlaetdgplprppgyclfelc
    lesvefwgngterlherlrydrdeggwkhrylqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t9mA (A:)
    ltgtieapfpefeappanpmevlrnwlerarrygvrepralalatvdgqgrpstrivvia
    elgergvvfathadsqkgrelaqnpwasgvlywressqqiilngraerlpderadaqwls
    rpyqthpmsiasrqsetladihalraearrlaetdgplprppgyclfelclesvefwgng
    terlherlrydrdeggwkhrylqp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t9mB (B:)
    mgvnanisesltgtieapfpefeappanpmevlrnwlerarrygvrepralalatvdgqg
    rpstrivviaelgergvvfathadsqkgrelaqnpwasgvlywressqqiilngraerlp
    deradaqwlsrpyqthpmsiasrqsetladihalraearrlaetdgplprppgyclfelc
    lesvefwgngterlherlrydrdeggwkhrylqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t9mB (B:)
    ltgtieapfpefeappanpmevlrnwlerarrygvrepralalatvdgqgrpstrivvia
    elgergvvfathadsqkgrelaqnpwasgvlywressqqiilngraerlpderadaqwls
    rpyqthpmsiasrqsetladihalraearrlaetdgplprppgyclfelclesvefwgng
    terlherlrydrdeggwkhrylqp