PDB entry 1t9k

View 1t9k on RCSB PDB site
Description: X-ray crystal structure of aIF-2B alpha subunit-related translation initiation factor [Thermotoga maritima]
Deposited on 2004-05-17, released 2004-06-08
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-08, with a file datestamp of 2004-06-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.239
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1t9ka_
  • Chain 'B':
    Domains in SCOP 1.69: d1t9kb_
  • Chain 'C':
    Domains in SCOP 1.69: d1t9kc_
  • Chain 'D':
    Domains in SCOP 1.69: d1t9kd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t9kA (A:)
    ghmklktktmewsgnslklldqrklpfieeyvecktheevahaikemivrgapaigvaaa
    fgyvlglrdyktgsltdwmkqvketlartrptavnlfwalnrmekvffenadrenlfeil
    enealkmayedievnkaigkngaqlikdgstilthcnagalatvdygtalgviraavesg
    krirvfadetrpylqgarltawelmkdgievyvitdnmagwlmkrglidavvvgadrial
    ngdtankigtyslavlakrnnipfyvaapvstidptirsgeeipieerrpeevthcggnr
    iapegvkvlnpafdvtentlitaiitekgvirppfeenikkilevgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t9kA (A:)
    lktktmewsgnslklldqrklpfieeyvecktheevahaikemivrgapaigvaaafgyv
    lglrdyktgsltdwmkqvketlartrptavnlfwalnrmekvffenadrenlfeilenea
    lkmayedievnkaigkngaqlikdgstilthcnagalatvdygtalgviraavesgkrir
    vfadetrpylqgarltawelmkdgievyvitdnmagwlmkrglidavvvgadrialngdt
    ankigtyslavlakrnnipfyvaapvstidptirsgeeipieerrpeevthcggnriape
    gvkvlnpafdvtentlitaiitekgvirppfeenikkile
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t9kB (B:)
    ghmklktktmewsgnslklldqrklpfieeyvecktheevahaikemivrgapaigvaaa
    fgyvlglrdyktgsltdwmkqvketlartrptavnlfwalnrmekvffenadrenlfeil
    enealkmayedievnkaigkngaqlikdgstilthcnagalatvdygtalgviraavesg
    krirvfadetrpylqgarltawelmkdgievyvitdnmagwlmkrglidavvvgadrial
    ngdtankigtyslavlakrnnipfyvaapvstidptirsgeeipieerrpeevthcggnr
    iapegvkvlnpafdvtentlitaiitekgvirppfeenikkilevgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t9kB (B:)
    lktktmewsgnslklldqrklpfieeyvecktheevahaikemivrgapaigvaaafgyv
    lglrdyktgsltdwmkqvketlartrptavnlfwalnrmekvffenadrenlfeilenea
    lkmayedievnkaigkngaqlikdgstilthcnagalatvdygtalgviraavesgkrir
    vfadetrpylqgarltawelmkdgievyvitdnmagwlmkrglidavvvgadrialngdt
    ankigtyslavlakrnnipfyvaapvstidptirsgeeipieerrpeevthcggnriape
    gvkvlnpafdvtentlitaiitekgvirppfeenikkile
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t9kC (C:)
    ghmklktktmewsgnslklldqrklpfieeyvecktheevahaikemivrgapaigvaaa
    fgyvlglrdyktgsltdwmkqvketlartrptavnlfwalnrmekvffenadrenlfeil
    enealkmayedievnkaigkngaqlikdgstilthcnagalatvdygtalgviraavesg
    krirvfadetrpylqgarltawelmkdgievyvitdnmagwlmkrglidavvvgadrial
    ngdtankigtyslavlakrnnipfyvaapvstidptirsgeeipieerrpeevthcggnr
    iapegvkvlnpafdvtentlitaiitekgvirppfeenikkilevgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t9kC (C:)
    mklktktmewsgnslklldqrklpfieeyvecktheevahaikemivrgapaigvaaafg
    yvlglrdyktgsltdwmkqvketlartrptavnlfwalnrmekvffenadrenlfeilen
    ealkmayedievnkaigkngaqlikdgstilthcnagalatvdygtalgviraavesgkr
    irvfadetrpylqgarltawelmkdgievyvitdnmagwlmkrglidavvvgadrialng
    dtankigtyslavlakrnnipfyvaapvstidptirsgeeipieerrpeevthcggnria
    pegvkvlnpafdvtentlitaiitekgvirppfeenikkile
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1t9kD (D:)
    ghmklktktmewsgnslklldqrklpfieeyvecktheevahaikemivrgapaigvaaa
    fgyvlglrdyktgsltdwmkqvketlartrptavnlfwalnrmekvffenadrenlfeil
    enealkmayedievnkaigkngaqlikdgstilthcnagalatvdygtalgviraavesg
    krirvfadetrpylqgarltawelmkdgievyvitdnmagwlmkrglidavvvgadrial
    ngdtankigtyslavlakrnnipfyvaapvstidptirsgeeipieerrpeevthcggnr
    iapegvkvlnpafdvtentlitaiitekgvirppfeenikkilevgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t9kD (D:)
    mklktktmewsgnslklldqrklpfieeyvecktheevahaikemivrgapaigvaaafg
    yvlglrdyktgsltdwmkqvketlartrptavnlfwalnrmekvffenadrenlfeilen
    ealkmayedievnkaigkngaqlikdgstilthcnagalatvdygtalgviraavesgkr
    irvfadetrpylqgarltawelmkdgievyvitdnmagwlmkrglidavvvgadrialng
    dtankigtyslavlakrnnipfyvaapvstidptirsgeeipieerrpeevthcggnria
    pegvkvlnpafdvtentlitaiitekgvirppfeenikkile