PDB entry 1t9j

View 1t9j on RCSB PDB site
Description: i-crei(q47e)/dna complex
Deposited on 2004-05-17, released 2004-11-16
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-16, with a file datestamp of 2004-11-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.238
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1t9ja_
  • Chain 'B':
    Domains in SCOP 1.71: d1t9jb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t9jA (A:)
    mntkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtektqrrwfldklvd
    eigvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespd
    kflevctwvdqiaalndsktrkttsetvravldslsekkkssp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t9jA (A:)
    tkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtektqrrwfldklvdei
    gvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdkf
    levctwvdqiaalndsktrkttsetvravld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t9jB (B:)
    mntkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtektqrrwfldklvd
    eigvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespd
    kflevctwvdqiaalndsktrkttsetvravldslsekkkssp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t9jB (B:)
    tkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtektqrrwfldklvdei
    gvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdkf
    levctwvdqiaalndsktrkttsetvravld