PDB entry 1t9i

View 1t9i on RCSB PDB site
Description: I-CreI(D20N)/DNA complex
Class: hydrolase/DNA
Keywords: protein, DNA
Deposited on 2004-05-17, released 2004-11-16
The last revision prior to the SCOP 1.73 freeze date was dated 2004-11-16, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.194
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA endonuclease I-crei
    Species: Chlamydomonas reinhardtii
    Gene: CR.LSU INTRON OF CHOROPLAST 23S RRNA GENE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05725
      • engineered (19)
      • see remark 999 (41)
      • see remark 999 (109-110)
    Domains in SCOP 1.73: d1t9ia_
  • Chain 'B':
    Compound: DNA endonuclease I-crei
    Species: Chlamydomonas reinhardtii
    Gene: CR.LSU INTRON OF CHOROPLAST 23S RRNA GENE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05725
      • engineered (19)
      • see remark 999 (41)
      • see remark 999 (109-110)
    Domains in SCOP 1.73: d1t9ib_
  • Chain 'C':
    Compound: 5'-d(*gp*cp*ap*ap*ap*ap*cp*gp*tp*cp*gp*tp*gp*ap*gp*ap*cp*ap*gp*tp*tp*tp*cp*g)-3'
  • Chain 'D':
    Compound: 5'-d(*cp*gp*ap*ap*ap*cp*tp*gp*tp*cp*tp*cp*ap*cp*gp*ap*cp*gp*tp*tp*tp*tp*gp*c)-3'
  • Heterogens: CA, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t9iA (A:)
    mntkynkefllylagfvdgngsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvd
    eigvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespd
    kflevctwvdqiaalndsktrkttsetvravldslsekkkssp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t9iA (A:)
    ntkynkefllylagfvdgngsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvde
    igvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
    flevctwvdqiaalndsktrkttsetvravlds
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t9iB (B:)
    mntkynkefllylagfvdgngsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvd
    eigvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespd
    kflevctwvdqiaalndsktrkttsetvravldslsekkkssp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t9iB (B:)
    ntkynkefllylagfvdgngsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvde
    igvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
    flevctwvdqiaalndsktrkttsetvravldsls
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.