PDB entry 1t9i

View 1t9i on RCSB PDB site
Description: i-crei(d20n)/dna complex
Deposited on 2004-05-17, released 2004-11-16
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-16, with a file datestamp of 2004-11-16.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.194
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1t9ia_
  • Chain 'B':
    Domains in SCOP 1.71: d1t9ib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t9iA (A:)
    mntkynkefllylagfvdgngsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvd
    eigvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespd
    kflevctwvdqiaalndsktrkttsetvravldslsekkkssp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t9iA (A:)
    ntkynkefllylagfvdgngsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvde
    igvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
    flevctwvdqiaalndsktrkttsetvravlds
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t9iB (B:)
    mntkynkefllylagfvdgngsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvd
    eigvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespd
    kflevctwvdqiaalndsktrkttsetvravldslsekkkssp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t9iB (B:)
    ntkynkefllylagfvdgngsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvde
    igvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
    flevctwvdqiaalndsktrkttsetvravldsls