PDB entry 1t9h

View 1t9h on RCSB PDB site
Description: The crystal structure of YloQ, a circularly permuted GTPase.
Deposited on 2004-05-17, released 2004-11-02
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-02, with a file datestamp of 2004-11-02.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.146
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t9hA (A:)
    marhhhhhhmpegkiikalsgfyyvldesedsdkviqcrgrgifrknkitplvgdyvvyq
    aendkegylmeikertnelirppicnvdqavlvfsavqpsfstalldrflvlveandiqp
    iicitkmdliedqdtedtiqayaedyrnigydvyltsskdqdsladiiphfqdkttvfag
    qsgvgkssllnaispelglrtneisehlgrgkhttrhvelihtsgglvadtpgfssleft
    dieeeelgytfpdireksssckfrgclhlkepkcavkqavedgelkqyrydhyvefmtei
    kdrkpry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t9hA (A:)
    arhhhhhhmpegkiikalsgfyyvldesedsdkviqcrgrgifrknkitplvgdyvvyqa
    endkegylmeikertnelirppicnvdqavlvfsavqpsfstalldrflvlveandiqpi
    icitkmdliedqdtedtiqayaedyrnigydvyltsskdqdsladiiphfqdkttvfagq
    sgvgkssllnaisptrhvelihtsgglvadtpgfssleftdieeeelgytfpdireksss
    ckfrgclhlkepkcavkqavedgelkqyrydhyvefmteikdrkpry