PDB entry 1t9g

View 1t9g on RCSB PDB site
Description: Structure of the human MCAD:ETF complex
Class: oxidoreductase, electron transport
Keywords: electron transfer, protein:protein complex, fatty acid oxidation, human electron transferring flavoprotein, human medium chain acyl coa dehydrogenase
Deposited on 2004-05-17, released 2004-06-08
The last revision prior to the SCOP 1.73 freeze date was dated 2004-08-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.195
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl-CoA dehydrogenase, medium-chain specific, mitochondrial
    Species: HOMO SAPIENS
    Gene: ACADM
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1t9ga1, d1t9ga2
  • Chain 'B':
    Compound: Acyl-CoA dehydrogenase, medium-chain specific, mitochondrial
    Species: HOMO SAPIENS
    Gene: ACADM
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1t9gb1, d1t9gb2
  • Chain 'C':
    Compound: Acyl-CoA dehydrogenase, medium-chain specific, mitochondrial
    Species: HOMO SAPIENS
    Gene: ACADM
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1t9gc1, d1t9gc2
  • Chain 'D':
    Compound: Acyl-CoA dehydrogenase, medium-chain specific, mitochondrial
    Species: HOMO SAPIENS
    Gene: ACADM
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1t9gd1, d1t9gd2
  • Chain 'R':
    Compound: Electron transfer flavoprotein alpha-subunit, mitochondrial
    Species: HOMO SAPIENS
    Gene: ETFA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1t9gr_
  • Chain 'S':
    Compound: Electron transfer flavoprotein beta-subunit
    Species: HOMO SAPIENS
    Gene: ETFB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1t9gs_
  • Heterogens: AMP, FAD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t9gA (A:)
    kanrqrepglgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelg
    lmnthipencgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkky
    lgrmteeplmcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyflla
    rsdpdpkapankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvlig
    dgagfkvamgafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlae
    mamkvelarmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfntey
    pveklmrdakiyqiyegtsqiqrlivarehidkykn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t9gA (A:)
    lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
    cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
    mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
    ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligdgagfkvam
    gafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaemamkvelar
    msyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteypveklmrda
    kiyqiyegtsqiqrlivarehidkyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t9gB (B:)
    kanrqrepglgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelg
    lmnthipencgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkky
    lgrmteeplmcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyflla
    rsdpdpkapankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvlig
    dgagfkvamgafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlae
    mamkvelarmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfntey
    pveklmrdakiyqiyegtsqiqrlivarehidkykn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t9gB (B:)
    lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
    cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
    mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
    ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligdgagfkvam
    gafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaemamkvelar
    msyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteypveklmrda
    kiyqiyegtsqiqrlivarehidkykn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t9gC (C:)
    kanrqrepglgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelg
    lmnthipencgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkky
    lgrmteeplmcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyflla
    rsdpdpkapankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvlig
    dgagfkvamgafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlae
    mamkvelarmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfntey
    pveklmrdakiyqiyegtsqiqrlivarehidkykn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t9gC (C:)
    glgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipe
    ncgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteep
    lmcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpka
    pankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligdgagfkva
    mgafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaemamkvela
    rmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteypveklmrd
    akiyqiyegtsqiqrlivarehidkykn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1t9gD (D:)
    kanrqrepglgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelg
    lmnthipencgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkky
    lgrmteeplmcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyflla
    rsdpdpkapankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvlig
    dgagfkvamgafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlae
    mamkvelarmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfntey
    pveklmrdakiyqiyegtsqiqrlivarehidkykn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t9gD (D:)
    lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
    cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
    mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
    ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligdgagfkvam
    gafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaemamkvelar
    msyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteypveklmrda
    kiyqiyegtsqiqrlivarehidkykn
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1t9gR (R:)
    mfraaapgqlrraasllrfqstlviaehandslapitlntitaatrlggevsclvagtkc
    dkvaqdlckvagiakvlvaqhdvykgllpeeltplilatqkqfnythicagasafgknll
    prvaaklevapisdiiaikspdtfvrtiyagnalctvkcdekvkvfsvrgtsfdaaatsg
    gsassekasstspveisewldqkltksdrpeltgakvvvsggrglksgenfkllydladq
    lhaavgasraavdagfvpndmqvgqtgkivapelyiavgisgaiqhlagmkdsktivain
    kdpeapifqvadygivadlfkvvpemteilkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t9gR (R:)
    qstlviaehandslapitlntitaatrlggevsclvagtkcdkvaqdlckvagiakvlva
    qhdvykgllpeeltplilatqkqfnythicagasafgknllprvaaklevapisdiiaik
    spdtfvrtiyagnalctvkcdekvkvfsvrgtsfdaaatsggsassekasstspveisew
    ldqk
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1t9gS (S:)
    maelrvlvavkrvidyavkirvkpdrtgvvtdgvkhsmnpfceiaveeavrlkekklvke
    viavscgpaqcqetirtalamgadrgihvevppaeaerlgplqvarvlaklaekekvdlv
    llgkqaidddcnqtgqmtagfldwpqgtfasqvtlegdklkvereidggletlrlklpav
    vtadlrlnepryatlpnimkakkkkievikpgdlgvdltsklsvisvedppqrtagvkve
    ttedlvaklkeigri
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t9gS (S:)
    lrvlvavkrvidyavkirvkpdrtgvvtdgvkhsmnpfceiaveeavrlkekklvkevia
    vscgpaqcqetirtalamgadrgihvevppaeaerlgplqvarvlaklaekekvdlvllg
    kqaidddcnqtgqmtagfldwpqgtfasqvtlegdklkvereidggletlrlklpavvta
    dlrlnepryatlpnimkakkkkievikpgdlgvdltsklsvisvedpp