PDB entry 1t9b

View 1t9b on RCSB PDB site
Description: crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron
Deposited on 2004-05-16, released 2004-12-21
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-21, with a file datestamp of 2004-12-21.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.162
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t9bA (A:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkamgsapsfnvdpleqpa
    epsklakklraepdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdk
    fnfvlpkheqgaghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgq
    vptsaigtdafqeadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlp
    kdvtaailrnpiptkttlpsnalnqltsraqdefvmqsinkaadlinlakkpvlyvgagi
    lnhadgprllkelsdraqipvtttlqglgsfdqedpksldmlgmhgcatanlavqnadli
    iavgarfddrvtgniskfapearraaaegrggiihfevspkninkvvqtqiavegdattn
    lgkmmskifpvkersewfaqinkwkkeypyaymeetpgskikpqtvikklskvandtgrh
    vivttgvgqhqmwaaqhwtwrnphtfitsgglgtmgyglpaaigaqvakpeslvididgd
    asfnmtltelssavqagtpvkililnneeqgmvtqwqslfyehryshthqlnpdfiklae
    amglkglrvkkqeeldaklkefvstkgpvllevevdkkvpvlpmvaggsgldefinfdpe
    verqqtelrhkrtggkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t9bA (A:)
    mdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqgagh
    maegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdafqea
    dvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnpipf
    vmqsinkaadlinlakkpvlyvgagilnhadgprllkelsdraqipvtttlqglgsfdqe
    dpksldmlgmhgcatanlavqnadliiavgarfddrvtgniskfapearraaaegrggii
    hfevspkninkvvqtqiavegdattnlgkmmskifpvkersewfaqinkwkkeypyayme
    etpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwrnphtfitsgglgt
    mgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvkililnneeqgmvt
    qwqslfyehryshthqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpvlleve
    vdkkvpvlpmvaggsgldefinfdpeverqqtelrhkrtggkh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t9bB (B:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkamgsapsfnvdpleqpa
    epsklakklraepdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdk
    fnfvlpkheqgaghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgq
    vptsaigtdafqeadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlp
    kdvtaailrnpiptkttlpsnalnqltsraqdefvmqsinkaadlinlakkpvlyvgagi
    lnhadgprllkelsdraqipvtttlqglgsfdqedpksldmlgmhgcatanlavqnadli
    iavgarfddrvtgniskfapearraaaegrggiihfevspkninkvvqtqiavegdattn
    lgkmmskifpvkersewfaqinkwkkeypyaymeetpgskikpqtvikklskvandtgrh
    vivttgvgqhqmwaaqhwtwrnphtfitsgglgtmgyglpaaigaqvakpeslvididgd
    asfnmtltelssavqagtpvkililnneeqgmvtqwqslfyehryshthqlnpdfiklae
    amglkglrvkkqeeldaklkefvstkgpvllevevdkkvpvlpmvaggsgldefinfdpe
    verqqtelrhkrtggkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t9bB (B:)
    mdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqgagh
    maegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdafqea
    dvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnpipt
    kttlpsraqdefvmqsinkaadlinlakkpvlyvgagilnhadgprllkelsdraqipvt
    ttlqglgsfdqedpksldmlgmhgcatanlavqnadliiavgarfddrvtgniskfapea
    rraaaegrggiihfevspkninkvvqtqiavegdattnlgkmmskifpvkersewfaqin
    kwkkeypyaymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwrn
    phtfitsgglgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvki
    lilnneeqgmvtqwqslfyehryshthqlnpdfiklaeamglkglrvkkqeeldaklkef
    vstkgpvllevevdkkvpvlpmvaggsgldefinfdpeverqqtelrhkrtggkh