PDB entry 1t93

View 1t93 on RCSB PDB site
Description: Evidence for Multiple Substrate Recognition and Molecular Mechanism of C-C reaction by Cytochrome P450 CYP158A2 from Streptomyces Coelicolor A3(2)
Class: oxidoreductase
Keywords: streptomyces, Cytochrome P450 oxidoreductase, CYP158A2, substrate recognition, molecular mechanism, OXIDOREDUCTASE
Deposited on 2004-05-14, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: 0.245
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative cytochrome P450
    Species: STREPTOMYCES COELICOLOR [TaxId:100226]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FCA6 (Start-403)
      • cloning artifact (404-405)
    Domains in SCOPe 2.07: d1t93a1, d1t93a2
  • Heterogens: HEM, FLV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t93A (A:)
    mteetisqavppvrdwpavdlpgsdfdpvltelmregpvtrislpngegwawlvtrhddv
    rlvtndprfgreavmdrqvtrlaphfipargavgfldppdhtrlrrsvaaaftargverv
    rersrgmldelvdamlragppadlteavlspfpiavicelmgvpatdrhsmhtwtqlils
    sshgaevseraknemnayfsdliglrsdsagedvtsllgaavgrdeitlseavglavllq
    iggeavtnnsgqmfhlllsrpelaerlrsepeirpraidellrwiphrnavglsrialed
    veikgvriragdavyvsylaanrdpevfpdpdridferspnphvsfgfgphycpggmlar
    lesellvdavldrvpglklavapedvpfkkgalirgpealpvtwaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t93A (A:)
    etisqavppvrdwpavdlpgsdfdpvltelmregpvtrislpngegwawlvtrhddvrlv
    tndprfgreavmdrqvtrlaphfipargavgfldppdhtrlrrsvaaaftargvervrer
    srgmldelvdamlragppadlteavlspfpiavicelmgvpatdrhsmhtwtqlilsssh
    gaevseraknemnayfsdliglrsdsagedvtsllgaavgrdeitlseavglavllqigg
    eavtnnsgqmfhlllsrpelaerlrsepeirpraidellrwiphrnavglsrialedvei
    kgvriragdavyvsylaanrdpevfpdpdridferspnphvsfgfgphycpggmlarles
    ellvdavldrvpglklavapedvpfkkgalirgpealpvtwaa