PDB entry 1t92

View 1t92 on RCSB PDB site
Description: Crystal structure of N-terminal truncated pseudopilin PulG
Class: protein transport
Keywords: domain-swapping, zinc, pseudopilin, PROTEIN TRANSPORT
Deposited on 2004-05-14, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.169
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: General secretion pathway protein G
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: PULG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15746 (Start-107)
      • cloning artifact (108)
    Domains in SCOPe 2.07: d1t92a1, d1t92a2
  • Chain 'B':
    Compound: General secretion pathway protein G
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: PULG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15746 (Start-107)
      • cloning artifact (108)
    Domains in SCOPe 2.07: d1t92b1, d1t92b2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t92A (A:)
    mgnkekadrqkvvsdlvalegaldmykldnsryptteqglqalvsapsaepharnypegg
    yirrlpqdpwgsdyqllspgqhgqvdifslgpdgvpesnddignwtigfhhhhhhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t92A (A:)
    gnkekadrqkvvsdlvalegaldmykldnsryptteqglqalvsapsaepharnypeggy
    irrlpqdpwgsdyqllspgqhgqvdifslgpdgvpesnddignwtigf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t92B (B:)
    mgnkekadrqkvvsdlvalegaldmykldnsryptteqglqalvsapsaepharnypegg
    yirrlpqdpwgsdyqllspgqhgqvdifslgpdgvpesnddignwtigfhhhhhhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t92B (B:)
    gnkekadrqkvvsdlvalegaldmykldnsryptteqglqalvsapsaepharnypeggy
    irrlpqdpwgsdyqllspgqhgqvdifslgpdgvpesnddignwtigf