PDB entry 1t91

View 1t91 on RCSB PDB site
Description: crystal structure of human small GTPase Rab7(GTP)
Class: protein transport
Keywords: protein transport, small GTPase
Deposited on 2004-05-14, released 2005-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.249
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-7
    Species: Homo sapiens [TaxId:9606]
    Gene: Rab7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51149
      • engineered (66)
    Domains in SCOPe 2.07: d1t91a1
  • Chain 'B':
    Compound: Ras-related protein Rab-7
    Species: Homo sapiens [TaxId:9606]
    Gene: Rab7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51149
      • engineered (66)
    Domains in SCOPe 2.07: d1t91b_
  • Chain 'C':
    Compound: Ras-related protein Rab-7
    Species: Homo sapiens [TaxId:9606]
    Gene: Rab7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51149
      • engineered (66)
    Domains in SCOPe 2.07: d1t91c_
  • Chain 'D':
    Compound: Ras-related protein Rab-7
    Species: Homo sapiens [TaxId:9606]
    Gene: Rab7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51149
      • engineered (66)
    Domains in SCOPe 2.07: d1t91d_
  • Heterogens: MG, GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t91A (A:)
    mtsrkkvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmq
    iwdtaglerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpf
    vvlgnkidlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetev
    elynefpepikldkndrakasaescsc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t91A (A:)
    vllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdtag
    lerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgnk
    idlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetevel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t91B (B:)
    mtsrkkvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmq
    iwdtaglerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpf
    vvlgnkidlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetev
    elynefpepikldkndrakasaescsc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t91B (B:)
    vllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdtag
    lerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgnk
    idlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetevel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t91C (C:)
    mtsrkkvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmq
    iwdtaglerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpf
    vvlgnkidlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetev
    elynefpepikldkndrakasaescsc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t91C (C:)
    vllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdtag
    lerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgnk
    idlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetevel
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1t91D (D:)
    mtsrkkvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmq
    iwdtaglerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpf
    vvlgnkidlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetev
    elynefpepikldkndrakasaescsc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t91D (D:)
    vllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdtag
    lerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgnk
    idlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetevel