PDB entry 1t8y

View 1t8y on RCSB PDB site
Description: Crystal Structure of E.coli AMP Nucleosidase complexed with phosphate
Class: hydrolase
Keywords: alpha-beta-alpha sandwich, alpha-beta fold, hydrolase
Deposited on 2004-05-13, released 2004-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.221
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AMP nucleosidase
    Species: Escherichia coli [TaxId:562]
    Gene: AMN, B1982, Z3139, ECS2779
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15272 (Start-483)
      • modified residue (137)
      • modified residue (259)
      • modified residue (301)
      • modified residue (403)
    Domains in SCOPe 2.07: d1t8ya_
  • Chain 'B':
    Compound: AMP nucleosidase
    Species: Escherichia coli [TaxId:562]
    Gene: AMN, B1982, Z3139, ECS2779
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15272 (Start-483)
      • modified residue (137)
      • modified residue (259)
      • modified residue (301)
      • modified residue (403)
    Domains in SCOPe 2.07: d1t8yb_
  • Chain 'C':
    Compound: AMP nucleosidase
    Species: Escherichia coli [TaxId:562]
    Gene: AMN, B1982, Z3139, ECS2779
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15272 (Start-483)
      • modified residue (137)
      • modified residue (259)
      • modified residue (301)
      • modified residue (403)
    Domains in SCOPe 2.07: d1t8yc_
  • Chain 'D':
    Compound: AMP nucleosidase
    Species: Escherichia coli [TaxId:562]
    Gene: AMN, B1982, Z3139, ECS2779
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15272 (Start-483)
      • modified residue (137)
      • modified residue (259)
      • modified residue (301)
      • modified residue (403)
    Domains in SCOPe 2.07: d1t8yd_
  • Chain 'E':
    Compound: AMP nucleosidase
    Species: Escherichia coli [TaxId:562]
    Gene: AMN, B1982, Z3139, ECS2779
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15272 (Start-483)
      • modified residue (137)
      • modified residue (259)
      • modified residue (301)
      • modified residue (403)
    Domains in SCOPe 2.07: d1t8ye_
  • Chain 'F':
    Compound: AMP nucleosidase
    Species: Escherichia coli [TaxId:562]
    Gene: AMN, B1982, Z3139, ECS2779
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15272 (Start-483)
      • modified residue (137)
      • modified residue (259)
      • modified residue (301)
      • modified residue (403)
    Domains in SCOPe 2.07: d1t8yf_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t8yA (A:)
    mnnkgsgltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvt
    wdgsttnppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqhe
    ipypyvidgseltldrsmsagltryfpttelaqigdetadgiyhptefsplshfdarrvd
    fslarlrhytgtpvehfqpfvlftnytryvdefvrwgcsqildpdspyialscaggnwit
    aeteapeeaisdlawkkhqmpawhlitadgqgitlvnigvgpsnakticdhlavlrpdvw
    lmighcgglresqaigdyvlahaylrddhvldavlppdipipsiaevqralydatklvsg
    rpgeevkqrlrtgtvvttddrnwelrysasalrfnlsravaidmesatiaaqgyrfrvpy
    gtllcvsdkplhgeiklpgqanrfyegaisehlqigiraidllraegdrlhsrklrtfne
    ppfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t8yA (A:)
    ltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvtwdgsttn
    ppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqheipypyvi
    dgseltldrsmsagltryfpttelfsplshfdarrvdfslarlrhytgtpvehfqpfvlf
    tnytryvdefvrwgcsqildpdspyialscaggnwitaeteapeeaisdlawkkhqmpaw
    hlitadgqgitlvnigvgpsnakticdhlavlrpdvwlmighcgglresqaigdyvlaha
    ylrddhvldavlppdipipsiaevqralydatklvsgrpgeevkqrlrtgtvvttddrnw
    elrysasalrfnlsravaidmesatiaaqgyrfrvpygtllcvsdkplhgeiklpgqanr
    fyegaisehlqigiraidllraegdrlhsrklrtfneppfr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t8yB (B:)
    mnnkgsgltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvt
    wdgsttnppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqhe
    ipypyvidgseltldrsmsagltryfpttelaqigdetadgiyhptefsplshfdarrvd
    fslarlrhytgtpvehfqpfvlftnytryvdefvrwgcsqildpdspyialscaggnwit
    aeteapeeaisdlawkkhqmpawhlitadgqgitlvnigvgpsnakticdhlavlrpdvw
    lmighcgglresqaigdyvlahaylrddhvldavlppdipipsiaevqralydatklvsg
    rpgeevkqrlrtgtvvttddrnwelrysasalrfnlsravaidmesatiaaqgyrfrvpy
    gtllcvsdkplhgeiklpgqanrfyegaisehlqigiraidllraegdrlhsrklrtfne
    ppfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t8yB (B:)
    ltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvtwdgsttn
    ppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqheipypyvi
    dgseltldrsmsagltryfpttelfsplshfdarrvdfslarlrhytgtpvehfqpfvlf
    tnytryvdefvrwgcsqildpdspyialscaggnwitaeteapeeaisdlawkkhqmpaw
    hlitadgqgitlvnigvgpsnakticdhlavlrpdvwlmighcgglresqaigdyvlaha
    ylrddhvldavlppdipipsiaevqralydatklvsgrpgeevkqrlrtgtvvttddrnw
    elrysasalrfnlsravaidmesatiaaqgyrfrvpygtllcvsdkplhgeiklpgqanr
    fyegaisehlqigiraidllraegdrlhsrklrtfneppfr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t8yC (C:)
    mnnkgsgltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvt
    wdgsttnppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqhe
    ipypyvidgseltldrsmsagltryfpttelaqigdetadgiyhptefsplshfdarrvd
    fslarlrhytgtpvehfqpfvlftnytryvdefvrwgcsqildpdspyialscaggnwit
    aeteapeeaisdlawkkhqmpawhlitadgqgitlvnigvgpsnakticdhlavlrpdvw
    lmighcgglresqaigdyvlahaylrddhvldavlppdipipsiaevqralydatklvsg
    rpgeevkqrlrtgtvvttddrnwelrysasalrfnlsravaidmesatiaaqgyrfrvpy
    gtllcvsdkplhgeiklpgqanrfyegaisehlqigiraidllraegdrlhsrklrtfne
    ppfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t8yC (C:)
    ltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvtwdgsttn
    ppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqheipypyvi
    dgseltldrsmsagltryfpttelfsplshfdarrvdfslarlrhytgtpvehfqpfvlf
    tnytryvdefvrwgcsqildpdspyialscaggnwitaeteapeeaisdlawkkhqmpaw
    hlitadgqgitlvnigvgpsnakticdhlavlrpdvwlmighcgglresqaigdyvlaha
    ylrddhvldavlppdipipsiaevqralydatklvsgrpgeevkqrlrtgtvvttddrnw
    elrysasalrfnlsravaidmesatiaaqgyrfrvpygtllcvsdkplhgeiklpgqanr
    fyegaisehlqigiraidllraegdrlhsrklrtfneppfr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1t8yD (D:)
    mnnkgsgltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvt
    wdgsttnppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqhe
    ipypyvidgseltldrsmsagltryfpttelaqigdetadgiyhptefsplshfdarrvd
    fslarlrhytgtpvehfqpfvlftnytryvdefvrwgcsqildpdspyialscaggnwit
    aeteapeeaisdlawkkhqmpawhlitadgqgitlvnigvgpsnakticdhlavlrpdvw
    lmighcgglresqaigdyvlahaylrddhvldavlppdipipsiaevqralydatklvsg
    rpgeevkqrlrtgtvvttddrnwelrysasalrfnlsravaidmesatiaaqgyrfrvpy
    gtllcvsdkplhgeiklpgqanrfyegaisehlqigiraidllraegdrlhsrklrtfne
    ppfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t8yD (D:)
    ltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvtwdgsttn
    ppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqheipypyvi
    dgseltldrsmsagltryfpttelfsplshfdarrvdfslarlrhytgtpvehfqpfvlf
    tnytryvdefvrwgcsqildpdspyialscaggnwitaeteapeeaisdlawkkhqmpaw
    hlitadgqgitlvnigvgpsnakticdhlavlrpdvwlmighcgglresqaigdyvlaha
    ylrddhvldavlppdipipsiaevqralydatklvsgrpgeevkqrlrtgtvvttddrnw
    elrysasalrfnlsravaidmesatiaaqgyrfrvpygtllcvsdkplhgeiklpgqanr
    fyegaisehlqigiraidllraegdrlhsrklrtfneppfr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1t8yE (E:)
    mnnkgsgltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvt
    wdgsttnppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqhe
    ipypyvidgseltldrsmsagltryfpttelaqigdetadgiyhptefsplshfdarrvd
    fslarlrhytgtpvehfqpfvlftnytryvdefvrwgcsqildpdspyialscaggnwit
    aeteapeeaisdlawkkhqmpawhlitadgqgitlvnigvgpsnakticdhlavlrpdvw
    lmighcgglresqaigdyvlahaylrddhvldavlppdipipsiaevqralydatklvsg
    rpgeevkqrlrtgtvvttddrnwelrysasalrfnlsravaidmesatiaaqgyrfrvpy
    gtllcvsdkplhgeiklpgqanrfyegaisehlqigiraidllraegdrlhsrklrtfne
    ppfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t8yE (E:)
    ltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvtwdgsttn
    ppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqheipypyvi
    dgseltldrsmsagltryfpttelfsplshfdarrvdfslarlrhytgtpvehfqpfvlf
    tnytryvdefvrwgcsqildpdspyialscaggnwitaeteapeeaisdlawkkhqmpaw
    hlitadgqgitlvnigvgpsnakticdhlavlrpdvwlmighcgglresqaigdyvlaha
    ylrddhvldavlppdipipsiaevqralydatklvsgrpgeevkqrlrtgtvvttddrnw
    elrysasalrfnlsravaidmesatiaaqgyrfrvpygtllcvsdkplhgeiklpgqanr
    fyegaisehlqigiraidllraegdrlhsrklrtfneppfr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1t8yF (F:)
    mnnkgsgltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvt
    wdgsttnppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqhe
    ipypyvidgseltldrsmsagltryfpttelaqigdetadgiyhptefsplshfdarrvd
    fslarlrhytgtpvehfqpfvlftnytryvdefvrwgcsqildpdspyialscaggnwit
    aeteapeeaisdlawkkhqmpawhlitadgqgitlvnigvgpsnakticdhlavlrpdvw
    lmighcgglresqaigdyvlahaylrddhvldavlppdipipsiaevqralydatklvsg
    rpgeevkqrlrtgtvvttddrnwelrysasalrfnlsravaidmesatiaaqgyrfrvpy
    gtllcvsdkplhgeiklpgqanrfyegaisehlqigiraidllraegdrlhsrklrtfne
    ppfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t8yF (F:)
    ltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvtwdgsttn
    ppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqheipypyvi
    dgseltldrsmsagltryfpttelfsplshfdarrvdfslarlrhytgtpvehfqpfvlf
    tnytryvdefvrwgcsqildpdspyialscaggnwitaeteapeeaisdlawkkhqmpaw
    hlitadgqgitlvnigvgpsnakticdhlavlrpdvwlmighcgglresqaigdyvlaha
    ylrddhvldavlppdipipsiaevqralydatklvsgrpgeevkqrlrtgtvvttddrnw
    elrysasalrfnlsravaidmesatiaaqgyrfrvpygtllcvsdkplhgeiklpgqanr
    fyegaisehlqigiraidllraegdrlhsrklrtfneppfr