PDB entry 1t8s

View 1t8s on RCSB PDB site
Description: Crystal Structure of E.coli AMP Nucleosidase complexed with formicin 5'-monophosphate
Class: hydrolase
Keywords: alpha-beta-alpha sandwich, alpha-beta fold, hydrolase
Deposited on 2004-05-13, released 2004-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.226
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AMP nucleosidase
    Species: Escherichia coli [TaxId:562]
    Gene: AMN, B1982, Z3139, ECS2779
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15272 (Start-483)
      • modified residue (137)
      • modified residue (259)
      • modified residue (301)
      • modified residue (403)
    Domains in SCOPe 2.07: d1t8sa_
  • Chain 'B':
    Compound: AMP nucleosidase
    Species: Escherichia coli [TaxId:562]
    Gene: AMN, B1982, Z3139, ECS2779
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15272 (Start-483)
      • modified residue (137)
      • modified residue (259)
      • modified residue (301)
      • modified residue (403)
    Domains in SCOPe 2.07: d1t8sb_
  • Chain 'C':
    Compound: AMP nucleosidase
    Species: Escherichia coli [TaxId:562]
    Gene: AMN, B1982, Z3139, ECS2779
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15272 (Start-483)
      • modified residue (137)
      • modified residue (259)
      • modified residue (301)
      • modified residue (403)
    Domains in SCOPe 2.07: d1t8sc_
  • Chain 'D':
    Compound: AMP nucleosidase
    Species: Escherichia coli [TaxId:562]
    Gene: AMN, B1982, Z3139, ECS2779
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15272 (Start-483)
      • modified residue (137)
      • modified residue (259)
      • modified residue (301)
      • modified residue (403)
    Domains in SCOPe 2.07: d1t8sd_
  • Chain 'E':
    Compound: AMP nucleosidase
    Species: Escherichia coli [TaxId:562]
    Gene: AMN, B1982, Z3139, ECS2779
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15272 (Start-483)
      • modified residue (137)
      • modified residue (259)
      • modified residue (301)
      • modified residue (403)
    Domains in SCOPe 2.07: d1t8se_
  • Chain 'F':
    Compound: AMP nucleosidase
    Species: Escherichia coli [TaxId:562]
    Gene: AMN, B1982, Z3139, ECS2779
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15272 (Start-483)
      • modified residue (137)
      • modified residue (259)
      • modified residue (301)
      • modified residue (403)
    Domains in SCOPe 2.07: d1t8sf_
  • Heterogens: FMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t8sA (A:)
    mnnkgsgltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvt
    wdgsttnppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqhe
    ipypyvidgseltldrsmsagltryfpttelaqigdetadgiyhptefsplshfdarrvd
    fslarlrhytgtpvehfqpfvlftnytryvdefvrwgcsqildpdspyialscaggnwit
    aeteapeeaisdlawkkhqmpawhlitadgqgitlvnigvgpsnakticdhlavlrpdvw
    lmighcgglresqaigdyvlahaylrddhvldavlppdipipsiaevqralydatklvsg
    rpgeevkqrlrtgtvvttddrnwelrysasalrfnlsravaidmesatiaaqgyrfrvpy
    gtllcvsdkplhgeiklpgqanrfyegaisehlqigiraidllraegdrlhsrklrtfne
    ppfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t8sA (A:)
    ltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvtwdgsttn
    ppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqheipypyvi
    ldrsmsagltryfpttfsplshfdarrvdfslarlrhytgtpvehfqpfvlftnytryvd
    efvrwgcsqildpdspyialscaggnwitaeteapeeaisdlawkkhqmpawhlitadgq
    gitlvnigvgpsnakticdhlavlrpdvwlmighcgglresqaigdyvlahaylrddhvl
    davlppdipipsiaevqralydatklvsgrpgeevkqrlrtgtvvttddrnwelrysasa
    lrfnlsravaidmesatiaaqgyrfrvpygtllcvsdkplhgeikgaisehlqigiraid
    llraegdrlhsrklrtfneppfr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t8sB (B:)
    mnnkgsgltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvt
    wdgsttnppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqhe
    ipypyvidgseltldrsmsagltryfpttelaqigdetadgiyhptefsplshfdarrvd
    fslarlrhytgtpvehfqpfvlftnytryvdefvrwgcsqildpdspyialscaggnwit
    aeteapeeaisdlawkkhqmpawhlitadgqgitlvnigvgpsnakticdhlavlrpdvw
    lmighcgglresqaigdyvlahaylrddhvldavlppdipipsiaevqralydatklvsg
    rpgeevkqrlrtgtvvttddrnwelrysasalrfnlsravaidmesatiaaqgyrfrvpy
    gtllcvsdkplhgeiklpgqanrfyegaisehlqigiraidllraegdrlhsrklrtfne
    ppfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t8sB (B:)
    ltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvtwdgsttn
    ppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqheipypyvi
    ldrsmsagltryfpttfsplshfdarrvdfslarlrhytgtpvehfqpfvlftnytryvd
    efvrwgcsqildpdspyialscaggnwitaeteapeeaisdlawkkhqmpawhlitadgq
    gitlvnigvgpsnakticdhlavlrpdvwlmighcgglresqaigdyvlahaylrddhvl
    davlppdipipsiaevqralydatklvsgrpgeevkqrlrtgtvvttddrnwelrysasa
    lrfnlsravaidmesatiaaqgyrfrvpygtllcvsdkplhgeikegaisehlqigirai
    dllraegdrlhsrklrtfneppfr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t8sC (C:)
    mnnkgsgltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvt
    wdgsttnppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqhe
    ipypyvidgseltldrsmsagltryfpttelaqigdetadgiyhptefsplshfdarrvd
    fslarlrhytgtpvehfqpfvlftnytryvdefvrwgcsqildpdspyialscaggnwit
    aeteapeeaisdlawkkhqmpawhlitadgqgitlvnigvgpsnakticdhlavlrpdvw
    lmighcgglresqaigdyvlahaylrddhvldavlppdipipsiaevqralydatklvsg
    rpgeevkqrlrtgtvvttddrnwelrysasalrfnlsravaidmesatiaaqgyrfrvpy
    gtllcvsdkplhgeiklpgqanrfyegaisehlqigiraidllraegdrlhsrklrtfne
    ppfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t8sC (C:)
    ltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvtwdgsttn
    ppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqheipypyvi
    ldrsmsagltryfpttfsplshfdarrvdfslarlrhytgtpvehfqpfvlftnytryvd
    efvrwgcsqildpdspyialscaggnwitaeteapeeaisdlawkkhqmpawhlitadgq
    gitlvnigvgpsnakticdhlavlrpdvwlmighcgglresqaigdyvlahaylrddhvl
    davlppdipipsiaevqralydatklvsgrpgeevkqrlrtgtvvttddrnwelrysasa
    lrfnlsravaidmesatiaaqgyrfrvpygtllcvsdkplhgeikgaisehlqigiraid
    llraegdrlhsrklrtfneppfr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1t8sD (D:)
    mnnkgsgltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvt
    wdgsttnppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqhe
    ipypyvidgseltldrsmsagltryfpttelaqigdetadgiyhptefsplshfdarrvd
    fslarlrhytgtpvehfqpfvlftnytryvdefvrwgcsqildpdspyialscaggnwit
    aeteapeeaisdlawkkhqmpawhlitadgqgitlvnigvgpsnakticdhlavlrpdvw
    lmighcgglresqaigdyvlahaylrddhvldavlppdipipsiaevqralydatklvsg
    rpgeevkqrlrtgtvvttddrnwelrysasalrfnlsravaidmesatiaaqgyrfrvpy
    gtllcvsdkplhgeiklpgqanrfyegaisehlqigiraidllraegdrlhsrklrtfne
    ppfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t8sD (D:)
    ltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvtwdgsttn
    ppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqheipypyvi
    ldrsmsagltryfpttfsplshfdarrvdfslarlrhytgtpvehfqpfvlftnytryvd
    efvrwgcsqildpdspyialscaggnwitaeteapeeaisdlawkkhqmpawhlitadgq
    gitlvnigvgpsnakticdhlavlrpdvwlmighcgglresqaigdyvlahaylrddhvl
    davlppdipipsiaevqralydatklvsgrpgeevkqrlrtgtvvttddrnwelrysasa
    lrfnlsravaidmesatiaaqgyrfrvpygtllcvsdkplhgeikgaisehlqigiraid
    llraegdrlhsrklrtfneppfr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1t8sE (E:)
    mnnkgsgltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvt
    wdgsttnppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqhe
    ipypyvidgseltldrsmsagltryfpttelaqigdetadgiyhptefsplshfdarrvd
    fslarlrhytgtpvehfqpfvlftnytryvdefvrwgcsqildpdspyialscaggnwit
    aeteapeeaisdlawkkhqmpawhlitadgqgitlvnigvgpsnakticdhlavlrpdvw
    lmighcgglresqaigdyvlahaylrddhvldavlppdipipsiaevqralydatklvsg
    rpgeevkqrlrtgtvvttddrnwelrysasalrfnlsravaidmesatiaaqgyrfrvpy
    gtllcvsdkplhgeiklpgqanrfyegaisehlqigiraidllraegdrlhsrklrtfne
    ppfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t8sE (E:)
    ltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvtwdgsttn
    ppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqheipypyvi
    ldrsmsagltryfpttfsplshfdarrvdfslarlrhytgtpvehfqpfvlftnytryvd
    efvrwgcsqildpdspyialscaggnwitaeteapeeaisdlawkkhqmpawhlitadgq
    gitlvnigvgpsnakticdhlavlrpdvwlmighcgglresqaigdyvlahaylrddhvl
    davlppdipipsiaevqralydatklvsgrpgeevkqrlrtgtvvttddrnwelrysasa
    lrfnlsravaidmesatiaaqgyrfrvpygtllcvsdkplhgeikgaisehlqigiraid
    llraegdrlhsrklrtfneppfr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1t8sF (F:)
    mnnkgsgltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvt
    wdgsttnppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqhe
    ipypyvidgseltldrsmsagltryfpttelaqigdetadgiyhptefsplshfdarrvd
    fslarlrhytgtpvehfqpfvlftnytryvdefvrwgcsqildpdspyialscaggnwit
    aeteapeeaisdlawkkhqmpawhlitadgqgitlvnigvgpsnakticdhlavlrpdvw
    lmighcgglresqaigdyvlahaylrddhvldavlppdipipsiaevqralydatklvsg
    rpgeevkqrlrtgtvvttddrnwelrysasalrfnlsravaidmesatiaaqgyrfrvpy
    gtllcvsdkplhgeiklpgqanrfyegaisehlqigiraidllraegdrlhsrklrtfne
    ppfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t8sF (F:)
    ltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvtwdgsttn
    ppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqheipypyvi
    ldrsmsagltryfpttfsplshfdarrvdfslarlrhytgtpvehfqpfvlftnytryvd
    efvrwgcsqildpdspyialscaggnwitaeteapeeaisdlawkkhqmpawhlitadgq
    gitlvnigvgpsnakticdhlavlrpdvwlmighcgglresqaigdyvlahaylrddhvl
    davlppdipipsiaevqralydatklvsgrpgeevkqrlrtgtvvttddrnwelrysasa
    lrfnlsravaidmesatiaaqgyrfrvpygtllcvsdkplhgeikgaisehlqigiraid
    llraegdrlhsrklrtfneppfr