PDB entry 1t8r

View 1t8r on RCSB PDB site
Description: Crystal Structure of E. coli AMP Nucleosidase
Deposited on 2004-05-13, released 2004-08-17
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-17, with a file datestamp of 2004-08-17.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.219
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1t8ra_
  • Chain 'B':
    Domains in SCOP 1.69: d1t8rb_
  • Chain 'C':
    Domains in SCOP 1.69: d1t8rc_
  • Chain 'D':
    Domains in SCOP 1.69: d1t8rd_
  • Chain 'E':
    Domains in SCOP 1.69: d1t8re_
  • Chain 'F':
    Domains in SCOP 1.69: d1t8rf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t8rA (A:)
    mnnkgsgltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvt
    wdgsttnppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqhe
    ipypyvidgseltldrsmsagltryfpttelaqigdetadgiyhptefsplshfdarrvd
    fslarlrhytgtpvehfqpfvlftnytryvdefvrwgcsqildpdspyialscaggnwit
    aeteapeeaisdlawkkhqmpawhlitadgqgitlvnigvgpsnakticdhlavlrpdvw
    lmighcgglresqaigdyvlahaylrddhvldavlppdipipsiaevqralydatklvsg
    rpgeevkqrlrtgtvvttddrnwelrysasalrfnlsravaidmesatiaaqgyrfrvpy
    gtllcvsdkplhgeiklpgqanrfyegaisehlqigiraidllraegdrlhsrklrtfne
    ppfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t8rA (A:)
    ltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvtwdgsttn
    ppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqheipypyvi
    dgseltldrsmsagltryfpttelaqfsplshfdarrvdfslarlrhytgtpvehfqpfv
    lftnytryvdefvrwgcsqildpdspyialscaggnwitaeteapeeaisdlawkkhqmp
    awhlitadgqgitlvnigvgpsnakticdhlavlrpdvwlmighcgglresqaigdyvla
    haylrddhvldavlppdipipsiaevqralydatklvsgrpgeevkqrlrtgtvvttddr
    nwelrysasalrfnlsravaidmesatiaaqgyrfrvpygtllcvsdkplhgeiklpgqa
    nrfyegaisehlqigiraidllraegdrlhsrklrtfneppfr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t8rB (B:)
    mnnkgsgltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvt
    wdgsttnppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqhe
    ipypyvidgseltldrsmsagltryfpttelaqigdetadgiyhptefsplshfdarrvd
    fslarlrhytgtpvehfqpfvlftnytryvdefvrwgcsqildpdspyialscaggnwit
    aeteapeeaisdlawkkhqmpawhlitadgqgitlvnigvgpsnakticdhlavlrpdvw
    lmighcgglresqaigdyvlahaylrddhvldavlppdipipsiaevqralydatklvsg
    rpgeevkqrlrtgtvvttddrnwelrysasalrfnlsravaidmesatiaaqgyrfrvpy
    gtllcvsdkplhgeiklpgqanrfyegaisehlqigiraidllraegdrlhsrklrtfne
    ppfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t8rB (B:)
    ltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvtwdgsttn
    ppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqheipypyvi
    dgseltldrsmsagltryfpttelaqfsplshfdarrvdfslarlrhytgtpvehfqpfv
    lftnytryvdefvrwgcsqildpdspyialscaggnwitaeteapeeaisdlawkkhqmp
    awhlitadgqgitlvnigvgpsnakticdhlavlrpdvwlmighcgglresqaigdyvla
    haylrddhvldavlppdipipsiaevqralydatklvsgrpgeevkqrlrtgtvvttddr
    nwelrysasalrfnlsravaidmesatiaaqgyrfrvpygtllcvsdkplhgeiklpgqa
    nrfyegaisehlqigiraidllraegdrlhsrklrtfneppfr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t8rC (C:)
    mnnkgsgltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvt
    wdgsttnppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqhe
    ipypyvidgseltldrsmsagltryfpttelaqigdetadgiyhptefsplshfdarrvd
    fslarlrhytgtpvehfqpfvlftnytryvdefvrwgcsqildpdspyialscaggnwit
    aeteapeeaisdlawkkhqmpawhlitadgqgitlvnigvgpsnakticdhlavlrpdvw
    lmighcgglresqaigdyvlahaylrddhvldavlppdipipsiaevqralydatklvsg
    rpgeevkqrlrtgtvvttddrnwelrysasalrfnlsravaidmesatiaaqgyrfrvpy
    gtllcvsdkplhgeiklpgqanrfyegaisehlqigiraidllraegdrlhsrklrtfne
    ppfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t8rC (C:)
    ltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvtwdgsttn
    ppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqheipypyvi
    dgseltldrsmsagltryfpttelaqfsplshfdarrvdfslarlrhytgtpvehfqpfv
    lftnytryvdefvrwgcsqildpdspyialscaggnwitaeteapeeaisdlawkkhqmp
    awhlitadgqgitlvnigvgpsnakticdhlavlrpdvwlmighcgglresqaigdyvla
    haylrddhvldavlppdipipsiaevqralydatklvsgrpgeevkqrlrtgtvvttddr
    nwelrysasalrfnlsravaidmesatiaaqgyrfrvpygtllcvsdkplhgeiklpgqa
    nrfyegaisehlqigiraidllraegdrlhsrklrtfneppfr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1t8rD (D:)
    mnnkgsgltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvt
    wdgsttnppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqhe
    ipypyvidgseltldrsmsagltryfpttelaqigdetadgiyhptefsplshfdarrvd
    fslarlrhytgtpvehfqpfvlftnytryvdefvrwgcsqildpdspyialscaggnwit
    aeteapeeaisdlawkkhqmpawhlitadgqgitlvnigvgpsnakticdhlavlrpdvw
    lmighcgglresqaigdyvlahaylrddhvldavlppdipipsiaevqralydatklvsg
    rpgeevkqrlrtgtvvttddrnwelrysasalrfnlsravaidmesatiaaqgyrfrvpy
    gtllcvsdkplhgeiklpgqanrfyegaisehlqigiraidllraegdrlhsrklrtfne
    ppfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t8rD (D:)
    ltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvtwdgsttn
    ppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqheipypyvi
    dgseltldrsmsagltryfpttelaqfsplshfdarrvdfslarlrhytgtpvehfqpfv
    lftnytryvdefvrwgcsqildpdspyialscaggnwitaeteapeeaisdlawkkhqmp
    awhlitadgqgitlvnigvgpsnakticdhlavlrpdvwlmighcgglresqaigdyvla
    haylrddhvldavlppdipipsiaevqralydatklvsgrpgeevkqrlrtgtvvttddr
    nwelrysasalrfnlsravaidmesatiaaqgyrfrvpygtllcvsdkplhgeiklpgqa
    nrfyegaisehlqigiraidllraegdrlhsrklrtfneppfr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1t8rE (E:)
    mnnkgsgltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvt
    wdgsttnppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqhe
    ipypyvidgseltldrsmsagltryfpttelaqigdetadgiyhptefsplshfdarrvd
    fslarlrhytgtpvehfqpfvlftnytryvdefvrwgcsqildpdspyialscaggnwit
    aeteapeeaisdlawkkhqmpawhlitadgqgitlvnigvgpsnakticdhlavlrpdvw
    lmighcgglresqaigdyvlahaylrddhvldavlppdipipsiaevqralydatklvsg
    rpgeevkqrlrtgtvvttddrnwelrysasalrfnlsravaidmesatiaaqgyrfrvpy
    gtllcvsdkplhgeiklpgqanrfyegaisehlqigiraidllraegdrlhsrklrtfne
    ppfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t8rE (E:)
    ltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvtwdgsttn
    ppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqheipypyvi
    dgseltldrsmsagltryfpttelaqfsplshfdarrvdfslarlrhytgtpvehfqpfv
    lftnytryvdefvrwgcsqildpdspyialscaggnwitaeteapeeaisdlawkkhqmp
    awhlitadgqgitlvnigvgpsnakticdhlavlrpdvwlmighcgglresqaigdyvla
    haylrddhvldavlppdipipsiaevqralydatklvsgrpgeevkqrlrtgtvvttddr
    nwelrysasalrfnlsravaidmesatiaaqgyrfrvpygtllcvsdkplhgeiklpgqa
    nrfyegaisehlqigiraidllraegdrlhsrklrtfneppfr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1t8rF (F:)
    mnnkgsgltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvt
    wdgsttnppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqhe
    ipypyvidgseltldrsmsagltryfpttelaqigdetadgiyhptefsplshfdarrvd
    fslarlrhytgtpvehfqpfvlftnytryvdefvrwgcsqildpdspyialscaggnwit
    aeteapeeaisdlawkkhqmpawhlitadgqgitlvnigvgpsnakticdhlavlrpdvw
    lmighcgglresqaigdyvlahaylrddhvldavlppdipipsiaevqralydatklvsg
    rpgeevkqrlrtgtvvttddrnwelrysasalrfnlsravaidmesatiaaqgyrfrvpy
    gtllcvsdkplhgeiklpgqanrfyegaisehlqigiraidllraegdrlhsrklrtfne
    ppfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t8rF (F:)
    ltpaqaldkldalyeqsvvalrnaignyitsgelpdenarkqglfvypsltvtwdgsttn
    ppktrafgrfthagsytttitrptlfrsylneqltllyqdygahisvqpsqheipypyvi
    dgseltldrsmsagltryfpttelaqfsplshfdarrvdfslarlrhytgtpvehfqpfv
    lftnytryvdefvrwgcsqildpdspyialscaggnwitaeteapeeaisdlawkkhqmp
    awhlitadgqgitlvnigvgpsnakticdhlavlrpdvwlmighcgglresqaigdyvla
    haylrddhvldavlppdipipsiaevqralydatklvsgrpgeevkqrlrtgtvvttddr
    nwelrysasalrfnlsravaidmesatiaaqgyrfrvpygtllcvsdkplhgeiklpgqa
    nrfyegaisehlqigiraidllraegdrlhsrklrtfneppfr