PDB entry 1t8p

View 1t8p on RCSB PDB site
Description: Crystal structure of Human erythrocyte 2,3-bisphosphoglycerate mutase
Class: Isomerase
Keywords: Isomerase
Deposited on 2004-05-13, released 2004-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.2
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bisphosphoglycerate mutase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t8pa_
  • Chain 'B':
    Compound: Bisphosphoglycerate mutase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t8pb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t8pA (A:)
    mskyklimlrhgegawnkenrfcswvdqklnsegmeearncgkqlkalnfefdlvftsvl
    nrsihtawlileelgqewvpvesswrlnerhygaliglnreqmalnhgeeqvrlwrrsyn
    vtpppieeshpyyqeiyndrrykvcdvpldqlprseslkdvlerllpywneriapevlrg
    ktilisahgnssrallkhlegisdediinitlptgvpilleldenlravgphqflgdqea
    iqaaikkvedqgkvkqakklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t8pA (A:)
    skyklimlrhgegawnkenrfcswvdqklnsegmeearncgkqlkalnfefdlvftsvln
    rsihtawlileelgqewvpvesswrlnerhygaliglnreqmalnhgeeqvrlwrrsynv
    tpppieeshpyyqeiyndrrykvcdvpldqlprseslkdvlerllpywneriapevlrgk
    tilisahgnssrallkhlegisdediinitlptgvpilleldenlravgphqflgdqeai
    qaaikkved
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t8pB (B:)
    mskyklimlrhgegawnkenrfcswvdqklnsegmeearncgkqlkalnfefdlvftsvl
    nrsihtawlileelgqewvpvesswrlnerhygaliglnreqmalnhgeeqvrlwrrsyn
    vtpppieeshpyyqeiyndrrykvcdvpldqlprseslkdvlerllpywneriapevlrg
    ktilisahgnssrallkhlegisdediinitlptgvpilleldenlravgphqflgdqea
    iqaaikkvedqgkvkqakklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t8pB (B:)
    skyklimlrhgegawnkenrfcswvdqklnsegmeearncgkqlkalnfefdlvftsvln
    rsihtawlileelgqewvpvesswrlnerhygaliglnreqmalnhgeeqvrlwrrsynv
    tpppieeshpyyqeiyndrrykvcdvpldqlprseslkdvlerllpywneriapevlrgk
    tilisahgnssrallkhlegisdediinitlptgvpilleldenlravgphqflgdqeai
    qaaikkved