PDB entry 1t8k

View 1t8k on RCSB PDB site
Description: Crystal Structure of apo acyl carrier protein from E. coli
Class: lipid transport
Keywords: acp, LIPID TRANSPORT
Deposited on 2004-05-13, released 2004-09-07
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.134
AEROSPACI score: 0.93 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl carrier protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1t8ka_
  • Heterogens: ZN, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t8kA (A:)
    stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
    kittvqaaidyinghqa