PDB entry 1t8g

View 1t8g on RCSB PDB site
Description: crystal structure of phage t4 lysozyme mutant l32a/l33a/t34a/c54t/c97a/e108v
Deposited on 2004-05-12, released 2004-10-19
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-19, with a file datestamp of 2004-10-19.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.184
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1t8ga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t8gA (A:)
    mnifemlrideglrlkiykdtegyytigighaatkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgvtgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t8gA (A:)
    mnifemlrideglrlkiykdtegyytigighaaslnaakseldkaigrntngvitkdeae
    klfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgvtgvagftnslrmlqqk
    rwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk