PDB entry 1t8g

View 1t8g on RCSB PDB site
Description: Crystal structure of phage T4 lysozyme mutant L32A/L33A/T34A/C54T/C97A/E108V
Class: hydrolase
Keywords: lysozyme, poly-alanine, HYDROLASE
Deposited on 2004-05-12, released 2004-10-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.184
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: E
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-End)
      • engineered (31-32)
      • engineered (53)
      • engineered (96)
      • engineered (107)
    Domains in SCOPe 2.08: d1t8ga_
  • Heterogens: PO4, CL, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t8gA (A:)
    mnifemlrideglrlkiykdtegyytigighaatkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgvtgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t8gA (A:)
    mnifemlrideglrlkiykdtegyytigighaaslnaakseldkaigrntngvitkdeae
    klfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgvtgvagftnslrmlqqk
    rwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk