PDB entry 1t8c

View 1t8c on RCSB PDB site
Description: Structure of the C-type lectin domain of CD23
Class: immune system
Keywords: c-type lectin, fcerII, fc receptor, IgE
Deposited on 2004-05-12, released 2005-07-26
The last revision prior to the SCOP 1.75 freeze date was dated 2005-10-04, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Low affinity immunoglobulin epsilon Fc receptor
    Species: HOMO SAPIENS
    Gene: FCER2, IGEBF
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1t8ca1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1t8cA (A:)
sgfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhas
htgswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwndafcdr
klgawvcdrlatctppasegsae