PDB entry 1t8b

View 1t8b on RCSB PDB site
Description: Crystal structure of refolded PHOU-like protein (gi 2983430) from Aquifex aeolicus
Class: transport protein
Keywords: alpha-helical protein consisting of two 3-helix bundles, Structural Genomics, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, TRANSPORT PROTEIN
Deposited on 2004-05-11, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3.23 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphate transport system protein phoU homolog
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: PHOU, AQ_906
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t8ba_
  • Chain 'B':
    Compound: Phosphate transport system protein phoU homolog
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: PHOU, AQ_906
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t8bb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t8bA (A:)
    ggggggmklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidlle
    vdierrcirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpy
    vninfmseivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprn
    ikramhlsfvarhyeriadhaenvaeaaiylsegeivkhqhikekge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t8bA (A:)
    mklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidllevdierr
    cirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpyvninfm
    seivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprnikramh
    lsfvarhyeriadhaenvaeaaiylseg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t8bB (B:)
    ggggggmklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidlle
    vdierrcirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpy
    vninfmseivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprn
    ikramhlsfvarhyeriadhaenvaeaaiylsegeivkhqhikekge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t8bB (B:)
    mklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidllevdierr
    cirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpyvninfm
    seivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprnikramh
    lsfvarhyeriadhaenvaeaaiylseg