PDB entry 1t88

View 1t88 on RCSB PDB site
Description: Crystal Structure of the Ferrous Cytochrome P450cam (C334A)
Class: oxidoreductase
Keywords: cytochrome P450, oxidoreductase, heme enzyme
Deposited on 2004-05-11, released 2004-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450-cam
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMC, CYP101
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183 (Start-413)
      • engineered (333)
    Domains in SCOPe 2.07: d1t88a_
  • Chain 'B':
    Compound: Cytochrome P450-cam
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMC, CYP101
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183 (Start-413)
      • engineered (333)
    Domains in SCOPe 2.07: d1t88b_
  • Heterogens: K, HEM, CAM, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t88A (A:)
    ttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcng
    ghwiatrgqlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvg
    mpvvdklenriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyl
    tdqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakr
    mcglllvggldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgri
    ltsdyefhgvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgq
    hlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t88A (A:)
    nanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatr
    gqlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdkl
    enriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrp
    dgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllv
    ggldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyef
    hgvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarrei
    ivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t88B (B:)
    ttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcng
    ghwiatrgqlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvg
    mpvvdklenriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyl
    tdqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakr
    mcglllvggldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgri
    ltsdyefhgvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgq
    hlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t88B (B:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
    lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
    riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
    smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
    ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
    vqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiiv
    tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav