PDB entry 1t84

View 1t84 on RCSB PDB site
Description: Solution structure of the Wiskott-Aldrich Syndrome Protein (WASP) autoinhibited core domain complexed with (S)-wiskostatin, a small molecule inhibitor
Class: signaling protein
Keywords: alpha helix, beta-hairpin turn, signaling protein
Deposited on 2004-05-11, released 2004-07-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: wiskott-aldrich syndrome protein
    Species: Homo sapiens [TaxId:9606]
    Gene: WASP (residues 242-310 and 461-492)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42768 (0-68)
      • see remark 999 (69-74)
    • Uniprot P42768 (75-106)
    Domains in SCOPe 2.08: d1t84a_
  • Heterogens: WSK

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1t84A (A:)
sgfkhvshvgwdpqngfdvnnldpdlrslfsragiseaqltdaetskliydfiedqggle
avrqemrrqggsggsqsseglvgalmhvmqkrsraihssdegedqag