PDB entry 1t83

View 1t83 on RCSB PDB site
Description: crystal structure of a human type iii fc gamma receptor in complex with an fc fragment of igg1 (orthorhombic)
Deposited on 2004-05-11, released 2004-09-28
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-28, with a file datestamp of 2004-09-28.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.226
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t83A (A:)
    htcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgve
    vhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqp
    repqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgs
    fflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t83A (A:)
    lggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpree
    qynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlpps
    reemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdk
    srwqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t83B (B:)
    htcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgve
    vhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqp
    repqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgs
    fflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t83B (B:)
    pellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkp
    reeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytl
    ppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflysklt
    vdksrwqqgnvfscsvmhealhnhytqkslsl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t83C (C:)
    rtedlpkavvflepqwysvlekdsvtlkcqgayspednstqwfhneslissqassyfida
    atvndsgeyrcqtnlstlsdpvqlevhigwlllqaprwvfkeedpihlrchswkntalhk
    vtylqngkdrkyfhhnsdfhipkatlkdsgsyfcrglvgsknvssetvnititqgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t83C (C:)
    lpkavvflepqwysvlekdsvtlkcqgayspednstqwfhneslissqassyfidaatvn
    dsgeyrcqtnlstlsdpvqlevhigwlllqaprwvfkeedpihlrchswkntalhkvtyl
    qngkdrkyfhhnsdfhipkatlkdsgsyfcrglvgsknvssetvnit