PDB entry 1t82

View 1t82 on RCSB PDB site
Description: crystal structure of the putative thioesterase from shewanella oneidensis, northeast structural genomics target sor51
Deposited on 2004-05-11, released 2004-05-18
The last revision prior to the SCOP 1.69 freeze date was dated 2004-05-18, with a file datestamp of 2004-05-18.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.194
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1t82a_
  • Chain 'B':
    Domains in SCOP 1.69: d1t82b_
  • Chain 'C':
    Domains in SCOP 1.69: d1t82c_
  • Chain 'D':
    Domains in SCOP 1.69: d1t82d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t82A (A:)
    mghhhhhhshmdellnrlrqtwhstipvsefmqiaplsftdgelsvsaplapninlhhtm
    fagsiytimtltgwgmvwlqqqllnvdgdivladahirylapvtsapevkvrwpdtnlsp
    lqrgrkakvklevqlfcdgklcaqfdglyvsvpkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t82A (A:)
    mdellnrlrqtwhstipvsefmqiaplsftdgelsvsaplapninlhhtmfagsiytimt
    ltgwgmvwlqqqllnvdgdivladahirylapvtsapevkvrwpdtnlsplqrgrkakvk
    levqlfcdgklcaqfdglyvsvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t82B (B:)
    mghhhhhhshmdellnrlrqtwhstipvsefmqiaplsftdgelsvsaplapninlhhtm
    fagsiytimtltgwgmvwlqqqllnvdgdivladahirylapvtsapevkvrwpdtnlsp
    lqrgrkakvklevqlfcdgklcaqfdglyvsvpkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t82B (B:)
    hhhhmdellnrlrqtwhstipvsefmqiaplsftdgelsvsaplapninlhhtmfagsiy
    timtltgwgmvwlqqqllnvdgdivladahirylapvtsapevkvrwpdtnlsplqrgrk
    akvklevqlfcdgklcaqfdglyvsvp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t82C (C:)
    mghhhhhhshmdellnrlrqtwhstipvsefmqiaplsftdgelsvsaplapninlhhtm
    fagsiytimtltgwgmvwlqqqllnvdgdivladahirylapvtsapevkvrwpdtnlsp
    lqrgrkakvklevqlfcdgklcaqfdglyvsvpkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t82C (C:)
    dellnrlrqtwhstipvsefmqiaplsftdgelsvsaplapninlhhtmfagsiytimtl
    tgwgmvwlqqqllnvdgdivladahirylapvtsapevkvrwpdtnlsplqrgrkakvkl
    evqlfcdgklcaqfdglyvsvpkm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1t82D (D:)
    mghhhhhhshmdellnrlrqtwhstipvsefmqiaplsftdgelsvsaplapninlhhtm
    fagsiytimtltgwgmvwlqqqllnvdgdivladahirylapvtsapevkvrwpdtnlsp
    lqrgrkakvklevqlfcdgklcaqfdglyvsvpkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t82D (D:)
    mdellnrlrqtwhstipvsefmqiaplsftdgelsvsaplapninlhhtmfagsiytimt
    ltgwgmvwlqqqllnvdgdivladahirylapvtsapevkvrwpqrgrkakvklevqlfc
    dgklcaqfdglyvsvp