PDB entry 1t7p

View 1t7p on RCSB PDB site
Description: t7 dna polymerase complexed to dna primer/template,a nucleoside triphosphate, and its processivity factor thioredoxin
Deposited on 1997-09-24, released 1998-02-25
The last revision prior to the SCOP 1.71 freeze date was dated 1998-02-25, with a file datestamp of 1998-02-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.24
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t7pA (A:)
    mivsdieanallesvtkfhcgviydystaeyvsyrpsdfgayldaleaevargglivfhn
    ghkydvpaltklaklqlnrefhlprencidtlvlsrlihsnlkdtdmgllrsgklpgale
    awgyrlgemkgeykddfkrmleeqgeeyvdgmewwnfneemmdynvqdvvvtkallekll
    sdkhyfppeidftdvgyttfwsesleavdiehraawllakqerngfpfdtkaieelyvel
    aarrsellrkltetfgswyqpkggtemfchprtgkplpkypriktpkvggifkkpknkaq
    regrepceldtreyvagapytpvehvvfnpssrdhiqkklqeagwvptkytdkgapvvdd
    evlegvrvddpekqaaidlikeylmiqkrigqsaegdkawlryvaedgkihgsvnpngav
    tgrathafpnlaqipgvrspygeqcraafgaehhldgitgkpwvqagidasglelrclah
    fmarfdngeyaheilngdihtknqiaaelptrdnaktfiygflygagdekigqivgagke
    rgkelkkkflentpaiaalresiqqtlvessqwvageqqvkwkrrwikgldgrkvhvrsp
    haalntllqsagalicklwiikteemlvekglkhgwdgdfaymawvhdeiqvgcrteeia
    qvvietaqeamrwvgdhwnfrclldtegkmgpnwaich
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t7pA (A:)
    mivsdieanallesvtkfhcgviydystaeyvsyrpsdfgayldaleaevargglivfhn
    ghkydvpaltklaklqlnrefhlprencidtlvlsrlihsnlkdtdmgllrsgklpgale
    awgyrlgemkgeykddfkrmleeqgeeyvdgmewwnfneemmdynvqdvvvtkallekll
    sdkhyfppeidftdvgyttfwsesleavdiehraawllakqerngfpfdtkaieelyvel
    aarrsellrkltetfgswyqpkggtemfchprtgkplpkypriktpkeyvagapytpveh
    vvfnpssrdhiqkklqeagwvptkytdkgapvvddevlegvrvddpekqaaidlikeylm
    iqkrigqsaegdkawlryvaedgkihgsvnpngavtgrathafpnlaqipgvrspygeqc
    raafgaehhldgitgkpwvqagidasglelrclahfmarfdngeyaheilngdihtknqi
    aaelptrdnaktfiygflygagdekigqivgagkergkelkkkflentpaiaalresiqq
    tlvekwkrrwikgldgrkvhvrsphaalntllqsagalicklwiikteemlvekglkhgw
    dgdfaymawvhdeiqvgcrteeiaqvvietaqeamrwvgdhwnfrclldtegkmgpnwai
    ch
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t7pB (B:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t7pB (B:)
    kiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidq
    npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl