PDB entry 1t7n

View 1t7n on RCSB PDB site
Description: Crystal structure of the M564G mutant of murine CrAT
Class: transferase
Keywords: transferase
Deposited on 2004-05-10, released 2004-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.185
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carnitine acetyltransferase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47934 (21-End)
      • expression tag (18-20)
      • engineered (555)
    Domains in SCOPe 2.07: d1t7na1, d1t7na2, d1t7na3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t7nA (A:)
    mgsshhhhhhssglvprgshmahqdalprlpvpplqqsldyylkalqpivseeewahtkq
    lvdefqtsggvgerlqkglerrakkmenwlsewwlktaylqfrqpvviysspgvilpkqd
    fvdlqgqlrfaakliegvldfksmidnetlpveflggqplcmnqyyqilsscrvpgpkqd
    svvnflkskrppthitvvhnyqffeldvyhsdgtpltsdqifvqlekiwnsslqsnkepv
    giltsnhrntwakaynnlikdkvnresvnsiqksiftvcldkqvprvsddvyrnhvagqm
    lhgggskfnsgnrwfdktlqfivaedgscgmvyehaaaegppivalvdhvmeytkkpelv
    rspmvplpmpkklrfnitpeikndiekakqnlsimiqdldimmltfhhfgkdfpksekls
    pdafiqvalqlayyriygqacatyesaslrmfhlgrtdtirsasidslafvkgmgdstvp
    eqqkvellrkavqahraytdrairgeafdrhllglklqaiedlvsmpdifmdtsyaiamh
    fnlstsqvpaktdcvgffgpvvpdgygicynpmeahinfsvsaynscaetnaarmahyle
    kalldmrtllqnhprakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t7nA (A:)
    shmahqdalprlpvpplqqsldyylkalqpivseeewahtkqlvdefqtsggvgerlqkg
    lerrakkmenwlsewwlktaylqfrqpvviysspgvilpkqdfvdlqgqlrfaakliegv
    ldfksmidnetlpveflggqplcmnqyyqilsscrvpgpkqdsvvnflkskrppthitvv
    hnyqffeldvyhsdgtpltsdqifvqlekiwnsslqsnkepvgiltsnhrntwakaynnl
    ikdkvnresvnsiqksiftvcldkqvprvsddvyrnhvagqmlhgggskfnsgnrwfdkt
    lqfivaedgscgmvyehaaaegppivalvdhvmeytkkpelvrspmvplpmpkklrfnit
    peikndiekakqnlsimiqdldimmltfhhfgkdfpkseklspdafiqvalqlayyriyg
    qacatyesaslrmfhlgrtdtirsasidslafvkgmgdstvpeqqkvellrkavqahray
    tdrairgeafdrhllglklqaiedlvsmpdifmdtsyaiamhfnlstsqvpaktdcvgff
    gpvvpdgygicynpmeahinfsvsaynscaetnaarmahylekalldmrtllqnhprak