PDB entry 1t7j

View 1t7j on RCSB PDB site
Description: crystal structure of inhibitor amprenavir in complex with a multi-drug resistant variant of HIV-1 protease (L63P/V82T/I84V)
Class: hydrolase
Keywords: hiv-1 protease, drug resitance, thermodynamics, substrate envelope, hydrolase
Deposited on 2004-05-10, released 2005-05-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pol polyprotein
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35963 (0-98)
    • engineered (6)
    • engineered (13)
    • engineered (81)
    • engineered (83)
  Domains in SCOPe 2.07: d1t7ja_
• Chain 'B':
  Compound: Pol polyprotein
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35963 (0-98)
    • engineered (6)
    • engineered (13)
    • engineered (81)
    • engineered (83)
  Domains in SCOPe 2.07: d1t7jb_
• Heterogens: ACT, 478, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1t7jA (A:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
  qipieicghkaigtvlvgptptnvigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1t7jB (B:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
  qipieicghkaigtvlvgptptnvigrnlltqigctlnf