PDB entry 1t7j
View 1t7j on RCSB PDB site
Description: crystal structure of inhibitor amprenavir in complex with a multi-drug resistant variant of HIV-1 protease (L63P/V82T/I84V)
Class: hydrolase
Keywords: hiv-1 protease, drug resitance, thermodynamics, substrate envelope, hydrolase
Deposited on
2004-05-10, released
2005-05-10
The last revision prior to the SCOPe 2.06 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.203
AEROSPACI score: 0.39
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Pol polyprotein
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: pol
Database cross-references and differences (RAF-indexed):
- Uniprot P35963 (0-98)
- engineered (6)
- engineered (13)
- engineered (81)
- engineered (83)
Domains in SCOPe 2.06: d1t7ja_ - Chain 'B':
Compound: Pol polyprotein
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: pol
Database cross-references and differences (RAF-indexed):
- Uniprot P35963 (0-98)
- engineered (6)
- engineered (13)
- engineered (81)
- engineered (83)
Domains in SCOPe 2.06: d1t7jb_ - Heterogens: ACT, 478, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1t7jA (A:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptptnvigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1t7jB (B:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptptnvigrnlltqigctlnf