PDB entry 1t7i
View 1t7i on RCSB PDB site
Description: The structural and thermodynamic basis for the binding of TMC114, a next-generation HIV-1 protease inhibitor.
Class: hydrolase
Keywords: hiv-1 protease, drug resitance, thermodynamics, substrate envelope, hydrolase
Deposited on
2004-05-10, released
2005-05-10
The last revision prior to the SCOPe 2.08 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-25.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.163
AEROSPACI score: 0.73
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Pol polyprotein
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: pol
Database cross-references and differences (RAF-indexed):
- Uniprot P35963 (0-98)
- engineered (6)
- engineered (13)
- engineered (81)
- engineered (83)
Domains in SCOPe 2.08: d1t7ia_ - Chain 'B':
Compound: Pol polyprotein
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: pol
Database cross-references and differences (RAF-indexed):
- Uniprot P35963 (0-98)
- engineered (6)
- engineered (13)
- engineered (81)
- engineered (83)
Domains in SCOPe 2.08: d1t7ib_ - Heterogens: PO4, ACT, 017, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1t7iA (A:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptptnvigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1t7iB (B:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptptnvigrnlltqigctlnf