PDB entry 1t7i

View 1t7i on RCSB PDB site
Description: The structural and thermodynamic basis for the binding of TMC114, a next-generation HIV-1 protease inhibitor.
Class: hydrolase
Keywords: hiv-1 protease, drug resitance, thermodynamics, substrate envelope, hydrolase
Deposited on 2004-05-10, released 2005-05-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.163
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pol polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35963 (0-98)
      • engineered (6)
      • engineered (13)
      • engineered (81)
      • engineered (83)
    Domains in SCOPe 2.08: d1t7ia_
  • Chain 'B':
    Compound: Pol polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35963 (0-98)
      • engineered (6)
      • engineered (13)
      • engineered (81)
      • engineered (83)
    Domains in SCOPe 2.08: d1t7ib_
  • Heterogens: PO4, ACT, 017, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t7iA (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
    qipieicghkaigtvlvgptptnvigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t7iB (B:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
    qipieicghkaigtvlvgptptnvigrnlltqigctlnf