PDB entry 1t7d

View 1t7d on RCSB PDB site
Description: Crystal structure of Escherichia coli type I signal peptidase in complex with a lipopeptide inhibitor
Class: hydrolase/antibiotic
Keywords: signal peptidase, ser/lys dyad, hydrolase, lipopeptide, antibiotic, biaryl bridge, hydrolase-antibiotic complex
Deposited on 2004-05-09, released 2004-07-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: 0.23
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Signal peptidase I
    Species: Escherichia coli [TaxId:562]
    Gene: LEPB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1t7da_
  • Chain 'B':
    Compound: Signal peptidase I
    Species: Escherichia coli [TaxId:562]
    Gene: LEPB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1t7db_
  • Chain 'C':
    Compound: arylomycin a2
    Species: STREPTOMYCES TU [TaxId:1931]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR01115 (0-5)
    • NOR NOR00115 (0-5)
  • Chain 'D':
    Compound: arylomycin a2
    Species: STREPTOMYCES TU [TaxId:1931]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR01115 (0-5)
    • NOR NOR00115 (0-5)
  • Heterogens: M12, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t7dA (A:)
    mivrsfiyepfqipsgsmmptlligdfilvekfaygikdpiyqktlietghpkrgdivvf
    kypedpkldyikravglpgdkvtydpvskeltiqpgcssgqacenalpvtysnvepsdfv
    qtfsrrnggeatsgffevpknetkengirlserketlgdvthriltvpiaqdqvgmyyqq
    pgqqlatwivppgqyfmmgdnrdnsadsrywgfvpeanlvgrataiwmsfdkqegewptg
    lrlsriggih
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t7dA (A:)
    iyepfqipsgsmmptlligdfilvekfhpkrgdivvfkypedpkldyikravglpgdkvt
    ydpvskeltiqpgcnalpvtysnvepsdfvqtfsrreatsgffevpknetkengirlser
    ketlgdvthriltvpiaqdqvgmyyqqpgqqlatwivppgqyfmmgdnrdnsadsrywgf
    vpeanlvgrataiwmsfdlrlsriggih
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t7dB (B:)
    mivrsfiyepfqipsgsmmptlligdfilvekfaygikdpiyqktlietghpkrgdivvf
    kypedpkldyikravglpgdkvtydpvskeltiqpgcssgqacenalpvtysnvepsdfv
    qtfsrrnggeatsgffevpknetkengirlserketlgdvthriltvpiaqdqvgmyyqq
    pgqqlatwivppgqyfmmgdnrdnsadsrywgfvpeanlvgrataiwmsfdkqegewptg
    lrlsriggih
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t7dB (B:)
    iyepfqipsgsmmptlligdfilvekfaetghpkrgdivvfkypedpkldyikravglpg
    dkvtydpvskeltiqpgcssgqacenalpvtysnvepsdfvqtfssgffevpknetkeng
    irlserketlgdvthriltvpiaqdqvgmyyqqpgqqlatwivppgqyfmmgdnrdnsad
    srywgfvpeanlvgrataiwmsfdkqegewptglrlsriggih
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.