PDB entry 1t7c

View 1t7c on RCSB PDB site
Description: crystal structure of the p1 glu bpti mutant- bovine chymotrypsin complex
Class: hydrolase/hydrolase inhibitor
Keywords: chymotrypsin; serine proteinase; bovine pancreatic trypsin inhibitor; bpti; protein-protein interaction; non-cognate binding; s1 pocket; primary specificity; crystal structure, hydrolase/hydrolase inhibitor complex
Deposited on 2004-05-09, released 2005-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.194
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chymotrypsin A
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t7ca_
  • Chain 'B':
    Compound: pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974 (0-57)
      • engineered (14)
      • engineered (51)
    Domains in SCOPe 2.07: d1t7cb_
  • Chain 'C':
    Compound: Chymotrypsin A
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t7cc_
  • Chain 'D':
    Compound: pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974 (0-57)
      • engineered (14)
      • engineered (51)
    Domains in SCOPe 2.07: d1t7cd_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t7cA (A:)
    cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
    ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
    vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
    icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
    tlaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t7cA (A:)
    cgvpaiqpvlsivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsd
    vvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclp
    sasddfaagttcvttgwgltryantpdrlqqaslpllsntnckkywgtkikdamicagas
    gvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t7cB (B:)
    rpdfcleppytgpceariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t7cC (C:)
    cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
    ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
    vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
    icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
    tlaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t7cC (C:)
    cgvpaiqpvlsivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsd
    vvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclp
    sasddfaagttcvttgwgltryantpdrlqqaslpllsntnckkywgtkikdamicagas
    gvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t7cD (D:)
    rpdfcleppytgpceariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga