PDB entry 1t7b

View 1t7b on RCSB PDB site
Description: Crystal structure of mutant Lys8Gln of scorpion alpha-like neurotoxin BmK M1 from Buthus martensii Karsch
Class: toxin
Keywords: BmK M1 Mutant, Scorpion toxin, Buthus martensii Karsch
Deposited on 2004-05-09, released 2004-09-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.17
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-like neurotoxin BmK-I
    Species: Mesobuthus martensii [TaxId:34649]
    Gene: BmK M1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45697 (2-65)
      • cloning artifact (0-1)
      • engineered (9)
    Domains in SCOPe 2.01: d1t7ba_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1t7bA (A:)
nsvrdayiaqphncvyecarneycndlctkngaksgycqwvgkygngcwcielpdnvpir
vpgkch