PDB entry 1t79

View 1t79 on RCSB PDB site
Description: Crystal structure of the androgen receptor ligand binding domain in complex with a FxxLW motif
Deposited on 2004-05-08, released 2004-08-31
The last revision prior to the SCOP 1.71 freeze date was dated 2004-09-28, with a file datestamp of 2004-09-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.2
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1t79a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t79A (A:)
    gspgisgggggshiegyecqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelger
    qlvhvvkwakalpgfrnlhvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvf
    neyrmhksrmysqcvrmrhlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdel
    rmnyikeldriiackrknptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvd
    fpemmaeiisvqvpkilsgkvkpiyfhtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t79A (A:)
    cqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnl
    hvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmr
    hlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrkn
    ptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkils
    gkvkpiyfht