PDB entry 1t75

View 1t75 on RCSB PDB site
Description: Crystal structure of Escherichia coli beta carbonic anhydrase
Class: lyase
Keywords: Carbon Dioxide reversible hydrating enzyme, Structural Genomics, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, LYASE
Deposited on 2004-05-07, released 2004-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.198
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein yadF
    Species: Escherichia coli [TaxId:562]
    Gene: YADF, B0126, SF0123, S0125
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1t75a_
  • Chain 'B':
    Compound: Protein yadF
    Species: Escherichia coli [TaxId:562]
    Gene: YADF, B0126, SF0123, S0125
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1t75b_
  • Chain 'D':
    Compound: Protein yadF
    Species: Escherichia coli [TaxId:562]
    Gene: YADF, B0126, SF0123, S0125
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1t75d_
  • Chain 'E':
    Compound: Protein yadF
    Species: Escherichia coli [TaxId:562]
    Gene: YADF, B0126, SF0123, S0125
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1t75e_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t75A (A:)
    mkdidtlisnnalwskmlveedpgffeklaqaqkprflwigcsdsrvpaerltglepgel
    fvhrnvanlvihtdlnclsvvqyavdvlevehiiicghygcggvqaavenpelglinnwl
    lhirdiwfkhssllgempqerrldtlcelnvmeqvynlghstimqsawkrgqkvtihgwa
    ygihdgllrdldvtatnretleqryrhgisnlklkhanhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t75A (A:)
    kdidtlisnnalwskmlveedpgffeklaqaqkprflwigcsdsrvpaerltglepgelf
    vhrnvanlvihtdlnclsvvqyavdvlevehiiicghygcggvqaavenpelglinnwll
    hirdiwfkhssllgempqerrldtlcelnvmeqvynlghstimqsawkrgqkvtihgway
    gihdgllrdldvtatnretleqryrhgisnlklk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t75B (B:)
    mkdidtlisnnalwskmlveedpgffeklaqaqkprflwigcsdsrvpaerltglepgel
    fvhrnvanlvihtdlnclsvvqyavdvlevehiiicghygcggvqaavenpelglinnwl
    lhirdiwfkhssllgempqerrldtlcelnvmeqvynlghstimqsawkrgqkvtihgwa
    ygihdgllrdldvtatnretleqryrhgisnlklkhanhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t75B (B:)
    kdidtlisnnalwskmlveedpgffeklaqaqkprflwigcsdsrvpaerltglepgelf
    vhrnvanlvihtdlnclsvvqyavdvlevehiiicghygcggvqaavenpelglinnwll
    hirdiwfkhssllgempqerrldtlcelnvmeqvynlghstimqsawkrgqkvtihgway
    gihdgllrdldvtatnretleqryrhgisnlklk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1t75D (D:)
    mkdidtlisnnalwskmlveedpgffeklaqaqkprflwigcsdsrvpaerltglepgel
    fvhrnvanlvihtdlnclsvvqyavdvlevehiiicghygcggvqaavenpelglinnwl
    lhirdiwfkhssllgempqerrldtlcelnvmeqvynlghstimqsawkrgqkvtihgwa
    ygihdgllrdldvtatnretleqryrhgisnlklkhanhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t75D (D:)
    kdidtlisnnalwskmlveedpgffeklaqaqkprflwigcsdsrvpaerltglepgelf
    vhrnvanlvihtdlnclsvvqyavdvlevehiiicghygcggvqaavenpelglinnwll
    hirdiwfkhssllgempqerrldtlcelnvmeqvynlghstimqsawkrgqkvtihgway
    gihdgllrdldvtatnretleqryrhgisnlklk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1t75E (E:)
    mkdidtlisnnalwskmlveedpgffeklaqaqkprflwigcsdsrvpaerltglepgel
    fvhrnvanlvihtdlnclsvvqyavdvlevehiiicghygcggvqaavenpelglinnwl
    lhirdiwfkhssllgempqerrldtlcelnvmeqvynlghstimqsawkrgqkvtihgwa
    ygihdgllrdldvtatnretleqryrhgisnlklkhanhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t75E (E:)
    kdidtlisnnalwskmlveedpgffeklaqaqkprflwigcsdsrvpaerltglepgelf
    vhrnvanlvihtdlnclsvvqyavdvlevehiiicghygcggvqaavenpelglinnwll
    hirdiwfkhssllgempqerrldtlcelnvmeqvynlghstimqsawkrgqkvtihgway
    gihdgllrdldvtatnretleqryrhgisnlklk