PDB entry 1t74

View 1t74 on RCSB PDB site
Description: Crystal structure of the androgen receptor ligand binding domain in complex with a WxxLF motif
Class: hormone/growth factor receptor
Keywords: nuclear receptor, transcription factor, ligand binding domain, AF-2, androgen, testosterone, DHT, alpha-helical sandwich, HORMONE/GROWTH FACTOR RECEPTOR COMPLEX
Deposited on 2004-05-07, released 2004-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Androgen receptor
    Species: Pan troglodytes [TaxId:9598]
    Gene: Ar, Nr3c4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1t74a_
  • Chain 'B':
    Compound: WxxLF motif peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1T74 (0-End)
  • Heterogens: SO4, DHT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t74A (A:)
    gspgisgggggshiegyecqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelger
    qlvhvvkwakalpgfrnlhvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvf
    neyrmhksrmysqcvrmrhlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdel
    rmnyikeldriiackrknptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvd
    fpemmaeiisvqvpkilsgkvkpiyfhtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t74A (A:)
    qpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlh
    vddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrh
    lsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknp
    tscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsg
    kvkpiyfht
    

  • Chain 'B':
    No sequence available.