PDB entry 1t72

View 1t72 on RCSB PDB site
Description: Crystal structure of phosphate transport system protein phoU from Aquifex aeolicus
Class: transport protein
Keywords: helix bundle, Structural Genomics, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, TRANSPORT PROTEIN
Deposited on 2004-05-07, released 2004-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.216
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphate transport system protein phoU homolog
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: PHOU, AQ_906
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67053 (6-End)
      • cloning artifact (0-5)
      • modified residue (6)
      • modified residue (22)
      • modified residue (69)
      • modified residue (82)
      • modified residue (84)
      • modified residue (96)
      • modified residue (125)
      • modified residue (132)
      • modified residue (170)
      • modified residue (184)
    Domains in SCOPe 2.06: d1t72a1, d1t72a2
  • Chain 'B':
    Compound: Phosphate transport system protein phoU homolog
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: PHOU, AQ_906
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67053 (6-End)
      • cloning artifact (1-5)
      • modified residue (6)
      • modified residue (22)
      • modified residue (69)
      • modified residue (82)
      • modified residue (84)
      • modified residue (96)
      • modified residue (125)
      • modified residue (132)
      • modified residue (170)
      • modified residue (184)
    Domains in SCOPe 2.06: d1t72b1, d1t72b2
  • Chain 'D':
    Compound: Phosphate transport system protein phoU homolog
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: PHOU, AQ_906
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67053 (6-End)
      • cloning artifact (0-5)
      • modified residue (6)
      • modified residue (22)
      • modified residue (69)
      • modified residue (82)
      • modified residue (84)
      • modified residue (96)
      • modified residue (125)
      • modified residue (132)
      • modified residue (170)
      • modified residue (184)
    Domains in SCOPe 2.06: d1t72d1, d1t72d2
  • Chain 'E':
    Compound: Phosphate transport system protein phoU homolog
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: PHOU, AQ_906
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67053 (6-End)
      • cloning artifact (0-5)
      • modified residue (6)
      • modified residue (22)
      • modified residue (69)
      • modified residue (82)
      • modified residue (84)
      • modified residue (96)
      • modified residue (125)
      • modified residue (132)
      • modified residue (170)
      • modified residue (184)
    Domains in SCOPe 2.06: d1t72e1, d1t72e2
  • Chain 'F':
    Compound: Phosphate transport system protein phoU homolog
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: PHOU, AQ_906
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67053 (6-End)
      • cloning artifact (1-5)
      • modified residue (6)
      • modified residue (22)
      • modified residue (69)
      • modified residue (82)
      • modified residue (84)
      • modified residue (96)
      • modified residue (125)
      • modified residue (132)
      • modified residue (170)
      • modified residue (184)
    Domains in SCOPe 2.06: d1t72f1, d1t72f2
  • Chain 'G':
    Compound: Phosphate transport system protein phoU homolog
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: PHOU, AQ_906
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67053 (6-End)
      • cloning artifact (2-5)
      • modified residue (6)
      • modified residue (22)
      • modified residue (69)
      • modified residue (82)
      • modified residue (84)
      • modified residue (96)
      • modified residue (125)
      • modified residue (132)
      • modified residue (170)
      • modified residue (184)
    Domains in SCOPe 2.06: d1t72g1, d1t72g2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t72A (A:)
    ggggggmklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidlle
    vdierrcirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpy
    vninfmseivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprn
    ikramhlsfvarhyeriadhaenvaeaaiylsegeivkhqhikekge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t72A (A:)
    ggggggmklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidlle
    vdierrcirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpy
    vninfmseivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprn
    ikramhlsfvarhyeriadhaenvaeaaiylsege
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t72B (B:)
    ggggggmklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidlle
    vdierrcirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpy
    vninfmseivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprn
    ikramhlsfvarhyeriadhaenvaeaaiylsegeivkhqhikekge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t72B (B:)
    gggggmklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidllev
    dierrcirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpyv
    ninfmseivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprni
    kramhlsfvarhyeriadhaenvaeaaiylsege
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1t72D (D:)
    ggggggmklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidlle
    vdierrcirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpy
    vninfmseivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprn
    ikramhlsfvarhyeriadhaenvaeaaiylsegeivkhqhikekge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t72D (D:)
    ggggggmklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidlle
    vdierrcirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpy
    vninfmseivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprn
    ikramhlsfvarhyeriadhaenvaeaaiylsege
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1t72E (E:)
    ggggggmklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidlle
    vdierrcirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpy
    vninfmseivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprn
    ikramhlsfvarhyeriadhaenvaeaaiylsegeivkhqhikekge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t72E (E:)
    ggggggmklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidlle
    vdierrcirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpy
    vninfmseivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprn
    ikramhlsfvarhyeriadhaenvaeaaiylse
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1t72F (F:)
    ggggggmklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidlle
    vdierrcirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpy
    vninfmseivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprn
    ikramhlsfvarhyeriadhaenvaeaaiylsegeivkhqhikekge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t72F (F:)
    gggggmklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidllev
    dierrcirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpyv
    ninfmseivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprni
    kramhlsfvarhyeriadhaenvaeaaiylsege
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1t72G (G:)
    ggggggmklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidlle
    vdierrcirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpy
    vninfmseivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprn
    ikramhlsfvarhyeriadhaenvaeaaiylsegeivkhqhikekge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t72G (G:)
    ggggmklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidllevd
    ierrcirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpyvn
    infmseivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprnik
    ramhlsfvarhyeriadhaenvaeaaiylse