PDB entry 1t72

View 1t72 on RCSB PDB site
Description: Crystal structure of phosphate transport system protein phoU from Aquifex aeolicus
Deposited on 2004-05-07, released 2004-12-07
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-07, with a file datestamp of 2004-12-07.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.216
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1t72a_
  • Chain 'B':
    Domains in SCOP 1.71: d1t72b_
  • Chain 'D':
    Domains in SCOP 1.71: d1t72d_
  • Chain 'E':
    Domains in SCOP 1.71: d1t72e_
  • Chain 'F':
    Domains in SCOP 1.71: d1t72f_
  • Chain 'G':
    Domains in SCOP 1.71: d1t72g_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t72A (A:)
    ggggggmklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidlle
    vdierrcirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpy
    vninfmseivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprn
    ikramhlsfvarhyeriadhaenvaeaaiylsegeivkhqhikekge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t72A (A:)
    ggggggmklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidlle
    vdierrcirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpy
    vninfmseivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprn
    ikramhlsfvarhyeriadhaenvaeaaiylsege
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t72B (B:)
    ggggggmklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidlle
    vdierrcirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpy
    vninfmseivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprn
    ikramhlsfvarhyeriadhaenvaeaaiylsegeivkhqhikekge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t72B (B:)
    gggggmklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidllev
    dierrcirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpyv
    ninfmseivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprni
    kramhlsfvarhyeriadhaenvaeaaiylsege
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1t72D (D:)
    ggggggmklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidlle
    vdierrcirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpy
    vninfmseivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprn
    ikramhlsfvarhyeriadhaenvaeaaiylsegeivkhqhikekge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t72D (D:)
    ggggggmklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidlle
    vdierrcirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpy
    vninfmseivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprn
    ikramhlsfvarhyeriadhaenvaeaaiylsege
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1t72E (E:)
    ggggggmklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidlle
    vdierrcirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpy
    vninfmseivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprn
    ikramhlsfvarhyeriadhaenvaeaaiylsegeivkhqhikekge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t72E (E:)
    ggggggmklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidlle
    vdierrcirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpy
    vninfmseivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprn
    ikramhlsfvarhyeriadhaenvaeaaiylse
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1t72F (F:)
    ggggggmklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidlle
    vdierrcirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpy
    vninfmseivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprn
    ikramhlsfvarhyeriadhaenvaeaaiylsegeivkhqhikekge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t72F (F:)
    gggggmklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidllev
    dierrcirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpyv
    ninfmseivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprni
    kramhlsfvarhyeriadhaenvaeaaiylsege
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1t72G (G:)
    ggggggmklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidlle
    vdierrcirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpy
    vninfmseivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprn
    ikramhlsfvarhyeriadhaenvaeaaiylsegeivkhqhikekge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t72G (G:)
    ggggmklfkeleetkeqvikmaklvqeaidkatealnkqnvelaeevikgddtidllevd
    ierrcirmialyqpeagdlrmimgiykivsdlermgdeaeniaeraillaeepplkpyvn
    infmseivkemvndsvisfiqqdtllakkviekddtvdelyhqlerelmtyvledprnik
    ramhlsfvarhyeriadhaenvaeaaiylse