PDB entry 1t71

View 1t71 on RCSB PDB site
Description: Crystal structure of a novel phosphatase Mycoplasma pneumoniaefrom
Class: hydrolase
Keywords: Crystal; phosphatase; X-ray crystallography; Structural Genomics; Berkeley Structural Genomics Center; BSGC; PSI, Protein Structure Initiative, HYDROLASE
Deposited on 2004-05-07, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.215
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phosphatase
  Species: Mycoplasma pneumoniae M129 [TaxId:272634]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P75429 (0-280)
  Domains in SCOPe 2.07: d1t71a_
• Heterogens: FE, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1t71A (A:)
  mmnsikfiflgdvygkagrniiknnlaqlkskyqadlvivnaentthgkglslkhyeflk
  eagvnyitmgnhtwfqkldlavvinkkdlvrplnldtsfafhnlgqgslvfefnkakiri
  tnllgtsvplpfkttnpfkvlkelilkrdcdlhivdfhaettseknafcmafdgyvttif
  gththvpsadlritpkgsayitdvgmcgpgfgsviganpeqsirlfcagsrehfevskcg
  aqlngvffevdvntkkvikteairiveddprylkqdyfnli