PDB entry 1t6x

View 1t6x on RCSB PDB site
Description: Crystal structure of ADP bound TM379
Class: transferase
Keywords: Crystal; FAD Synthetase; ADP; X-ray crystallography; Structural Genomics, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, TRANSFERASE
Deposited on 2004-05-07, released 2004-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: 0.229
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Riboflavin kinase/FMN adenylyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t6xa1, d1t6xa2
  • Chain 'B':
    Compound: Riboflavin kinase/FMN adenylyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t6xb1, d1t6xb2
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t6xA (A:)
    mvvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrv
    emlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgv
    evyeiedvvvqgkrvssslirnlvqegrveeipaylgryfeiegivhkdrefgrklgfpt
    anidrgneklvdlkrgvylvrvhlpdgkkkfgvmnvgfrptvgdarnvkyevyildfegd
    lygqrlklevlkfmrdekkfdsieelkaaidqdvksarnmiddiinskfekeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6xA (A:)
    vvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrve
    mlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgve
    vyeiedvvvqgkrvssslirnlvqegrveeipaylgryfeiegivfptanidrgneklvd
    lkrgvylvrvhlpdgkkkfgvmnvgfrrnvkyevyildfegdlygqrlklevlkfmrdek
    keelkaaidqdvksarnmiddiinsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t6xB (B:)
    mvvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrv
    emlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgv
    evyeiedvvvqgkrvssslirnlvqegrveeipaylgryfeiegivhkdrefgrklgfpt
    anidrgneklvdlkrgvylvrvhlpdgkkkfgvmnvgfrptvgdarnvkyevyildfegd
    lygqrlklevlkfmrdekkfdsieelkaaidqdvksarnmiddiinskfekeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6xB (B:)
    vvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrve
    mlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgve
    vyeiedvvvqgkrvssslirnlvqegrveeipaylgryfeiegivhfptanidrgneklv
    dlkrgvylvrvhlpdgkkkfgvmnvgfnvkyevyildfegdlygqrlklevlkfmrdekk
    fdsieelkaaidqdvksarnmiddiinskf