PDB entry 1t6t

View 1t6t on RCSB PDB site
Description: putative protein from Aquifex aeolicus
Class: structural genomics, unknown function
Keywords: structural genomics, Aquifex aeolicus, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2004-05-07, released 2004-08-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.18
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Putative protein
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: NP_214428
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67859
      • modified residue (56)
      • modified residue (81)
    Domains in SCOPe 2.06: d1t6t1_
  • Chain '2':
    Compound: Putative protein
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: NP_214428
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67859
      • modified residue (56)
      • modified residue (81)
    Domains in SCOPe 2.06: d1t6t2_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1t6t1 (1:)
    mtkeprnlsewikelkkasreavilvegkndkkalskfsiknvidlsgkryadvvdmleg
    kwekvillfdldthgerinqkmkellssqgflvdenfrnflkkwniihieeinggkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6t1 (1:)
    prnlsewikelkkasreavilvegkndkkalskfsiknvidlsgkryadvvdmlegkwek
    villfdldthgerinqkmkellssqgflvdenfrnflkkwniihieei
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >1t6t2 (2:)
    mtkeprnlsewikelkkasreavilvegkndkkalskfsiknvidlsgkryadvvdmleg
    kwekvillfdldthgerinqkmkellssqgflvdenfrnflkkwniihieeinggkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6t2 (2:)
    eprnlsewikelkkasreavilvegkndkkalskfsiknvidlsgkryadvvdmlegkwe
    kvillfdldthgerinqkmkellssqgflvdenfrnflkkwniihieein