PDB entry 1t6s

View 1t6s on RCSB PDB site
Description: Crystal structure of a conserved hypothetical protein from Chlorobium tepidum
Class: structural genomics, unknown function
Keywords: a winged helix-turn-helix, Structural Genomics, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center
Deposited on 2004-05-07, released 2004-12-07
The last revision prior to the SCOP 1.75 freeze date was dated 2005-01-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.216
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: Chlorobium tepidum TLS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1t6sa1, d1t6sa2
  • Chain 'B':
    Compound: conserved hypothetical protein
    Species: Chlorobium tepidum TLS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1t6sb1, d1t6sb2
  • Heterogens: NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1t6sA (A:)
mqeqrqqllrslealifsseepvnlqtlsqitahkftpselqeavdelnrdyeatgrtfr
ihaiaggyrfltepefadlvrqllapviqrrlsrsmlevlavvawhqpvtkgeiqqirga
spdysidrllarglievrgradspgrplqygttevfldlfhl

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1t6sB (B:)
mqeqrqqllrslealifsseepvnlqtlsqitahkftpselqeavdelnrdyeatgrtfr
ihaiaggyrfltepefadlvrqllapviqrrlsrsmlevlavvawhqpvtkgeiqqirga
spdysidrllarglievrgradspgrplqygttevfldlfhl